KEGG   Enterobacter lignolyticus: Entcl_2072Help
Entry
Entcl_2072        CDS       T01342                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
esc  Enterobacter lignolyticus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Entcl_2072
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entcl_2072
   00620 Pyruvate metabolism
    Entcl_2072
   00650 Butanoate metabolism
    Entcl_2072
  Lipid metabolism
   00071 Fatty acid degradation
    Entcl_2072
  Amino acid metabolism
   00350 Tyrosine metabolism
    Entcl_2072
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Entcl_2072
   00626 Naphthalene degradation
    Entcl_2072
Enzymes [BR:esc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Entcl_2072
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Entcl_2072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2192688..2195366)
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IIEDKVIKNHFASEYIYNAYKDEKTCGVLSVDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFATHGGYMLQGKELKAVQDIILKNGALNAAIVGQP
AYKIAELAGFSVPETTKILIGEVKVVDESEPFAHEKLSPTLAMYRAKDFDDAVEKAEKLV
AMGGIGHTSCLYTDQDNQPERVAHFGQKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALVVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSIVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMVAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESVKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGREFKEGETVAVKAEAAPAKADKKAKKSA
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtcgagcgcgtaaaaaaagcccag
cgtgaatatgccaatttcacccaagaacaggttgataaaatcttccgcgcggccgctctg
gctgctgcagatgctcgaatccctctcgctaaaatggccgttgccgaatccggcatgggt
atcatcgaagataaagtgatcaaaaaccactttgcttctgagtatatctacaacgcctat
aaagatgagaaaacctgcggcgtgctgtctgtagacgacaccttcggcaccatcaccatc
gcagaacctatcggcatcatctgcggtatcgttccaacaactaacccgacctccacggct
atcttcaaatcgctgatcagcctgaagacccgtaacgccattatcttctccccgcatccg
cgtgctaaagacgctaccaacaaagcggcagatatcgttctgcaggcggcaatcgcagcg
ggtgcgccgaaagacctgattggctggatcgatcaaccttccgttgagctgtccaacgcg
ctgatgcaccaccctgacattaacctgattctggccaccggtggcccgggcatggttaaa
gcagcatacagctccggtaaaccagcaatcggcgtaggcgcaggcaacacccctgttgtt
atcgacgaaacggcagatatcaaacgtgcggtggcttccgtactgatgtctaaaaccttc
gacaacggcgttatctgtgcttccgagcagtccgttgttgttgttgattccgtctacgac
gcagtgcgcgagcgtttcgccacccacggcggctacatgctgcagggcaaagagctgaaa
gccgttcaggacatcatcctgaagaatggcgcgctgaacgccgctatcgtaggccagcct
gcgtacaaaatcgccgaactggctggtttctccgtaccagaaaccactaagattctgatt
ggcgaagtgaaagtcgttgacgaaagcgagccgtttgctcacgagaaactgtctccgacg
ctggctatgtaccgcgcgaaagatttcgatgacgcggtagagaaagcagagaagctggtc
gccatgggcggtatcggccatacctcttgcctgtacaccgaccaggacaaccagccagaa
cgcgtcgctcacttcggtcagaagatgaaaactgcgcgtatcctgatcaacaccccggct
tctcagggtggtatcggtgacctgtacaacttcaaactcgcaccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgtcgtggctcactgccaatcgcgctggatgaagtgattaccgatggtcacaaa
cgcgcgctggtcgtaactgaccgcttcctgttcaacaacggctacgcggatcagataacc
tccgtgctgaaagcggctggcgttgaaaccgaagtgttcttcgaagttgaagcggaccca
acgctgtctatcgttcgtaaaggcgccgagctcgctaactccttcaaaccggacgttatc
atcgcgctgggcggtggttccccgatggatgcggcgaaaatcatgtgggtaatgtatgag
cacccggaaacccacttcgaagaactggcgctgcgctttatggacatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatggtcgctgtcaccaccacttccggt
accggttctgaagttacgccgtttgcggtcgttaccgatgatgctaccggtcagaaatac
ccgctggctgactacgcgctgaccccggacatggcgatcgttgacgccaacctggtgatg
gatatgccgaagtccctgtgcgcattcggtggtctggatgcggtaacgcacgcgctggaa
gcttacgtttccgtactggcctctgagttctctgacggtcaggctctgcaggcgctgaag
ctgctgaaagaaaacctgcctgcgtcctaccacgaagggtctaaaaacccggtagcgcgt
gagcgtgttcacagtgccgccaccatcgccggtatcgcgtttgccaacgccttcctgggc
gtatgtcactccatggcgcacaagctgggttctcagttccacattcctcacggtctggcg
aacgcccttctgatcagcaacgttattcgctataacgccaacgacaacccgaccaagcag
actgcattcagccagtatgaccgtccgcaggctcgtcgtcgctatgccgaaatcgctgac
catctgggtctgagcgcaccgggtgaccgtactgcggcgaagattgagaaactgctggca
tggctggaaagcgttaaagctgaactgggcattccgaagtctatccgcgaagcgggcgtt
caggaagcagacttcctggcacacgtagacaaactgtctgaagatgcgtttgacgaccag
tgcaccggcgccaacccgcgttacccgctgatctccgagctgaaacagatcctgctggat
acttactacggccgtgagttcaaagaaggtgaaacggtagcggtgaaggcagaagccgca
ccggctaaagctgacaagaaagcgaagaaaagcgcctga

DBGET integrated database retrieval system