KEGG   Enterobacter lignolyticus: Entcl_2086Help
Entry
Entcl_2086        CDS       T01342                                 

Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
esc  Enterobacter lignolyticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Entcl_2086
   01230 Biosynthesis of amino acids
    Entcl_2086
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entcl_2086
   00030 Pentose phosphate pathway
    Entcl_2086
   00051 Fructose and mannose metabolism
    Entcl_2086
   00052 Galactose metabolism
    Entcl_2086
  Energy metabolism
   00680 Methane metabolism
    Entcl_2086
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Entcl_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2208312..2209244)
Genome map
AA seq 310 aa AA seqDB search
MTKIYTLTLAPSLDSATQTPQIYPEGKLRCSAPVFEPGGGGINVARAITFLGGAATAIFP
AGGATGEHLVALLAAERVPVEAVETQDWTRQNLHVHVKTSGEQYRFVMPGAALSDDEFAR
LEARVMAADAGAIIVISGSLPPGVSTGRLAEMIKTAQRHGLRCVIDSSGDALAAALSVGG
LELVKPNQKELSALVQRELTQPDDVRQAALELVRSGKAKRVVVSLGPQGALGVDASGSVQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAQNAPLEEMVRYGVAAGSAATLNQGTRLCSLENT
QNIYHYLCQI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagatctatacgctcacgttagcgccctctctcgacagcgctacgcagacccca
caaatttatcccgaaggtaaattacgctgcagcgcccccgtctttgagccgggtggcggc
ggcatcaacgttgcgcgcgctatcacctttcttggcggcgccgcgacggcgattttcccg
gcgggcggcgcaacgggcgagcacctggtcgccctgcttgccgcagagcgcgttccggta
gaagcggtcgaaacacaggactggacgcggcaaaacctgcacgtacatgttaagaccagc
ggcgagcaataccgtttcgtgatgccaggagccgcgctcagcgacgacgaatttgcccgc
ctggaggcccgggtgatggcggccgacgccggcgcgattatcgttattagcggcagcctg
ccgccgggcgtatccacggggcgtctggccgaaatgataaaaaccgcgcagcgacatggc
ctgcgctgcgttatcgacagctccggcgacgcgctggcggccgcgctcagcgtcggcggg
cttgagctggttaagccgaaccagaaggagcttagcgcgctggtccagcgcgagctgacc
cagcccgacgacgtgcgtcaggcagcgcttgaactcgtgcgcagcggcaaagcaaaacgc
gttgtggtatcgcttgggccacagggcgcgctgggcgtggacgccagcggttccgttcag
gtggtgccgccgccggtgaaaagccagagcaccgtcggcgccggggacagcatggtcggc
gccatgacgctgaagctggcgcaaaacgcgccgctggaggagatggtacgctatggcgta
gccgcaggcagcgcggccacgctaaaccagggcactcgcctgtgctcgcttgagaatacg
cagaatatttatcattatctgtgccagatatag

DBGET integrated database retrieval system