KEGG   Enterobacter lignolyticus: Entcl_2289Help
Entry
Entcl_2289        CDS       T01342                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
esc  Enterobacter lignolyticus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Entcl_2289
   00330 Arginine and proline metabolism
    Entcl_2289
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Entcl_2289
Enzymes [BR:esc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Entcl_2289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2419507..2420433)
Genome map
AA seq 308 aa AA seqDB search
MGTVIDNAMLEAILAEVTPLIGQGRVADYIPALACVDGAKLGIAISTVDGQHYCAGDARE
RFSIQSISKVLSLVVAMNHYQEEEIWQRVGKDPSGQPFNSLLQLEIEQGKPRNPFINAGA
LVVCDMLQSRLSAPRQRMLEIIRKLSGVGDIAYDAVVARSEFDHSARNAAIAWLMKSFGN
FHNDVATVLQNYFHYCALKMSCSELAQTFLFLANQGRSPRHEQAIITPLQSRQVNALMAT
CGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPQLDEAGNSLAGIAVLERLT
QRLGRSVF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgggaacggtcattgataacgctatgctggaggccattctggcggaggtcacgccgctg
attgggcagggcagagtggcggactatattccggcgctggcctgcgttgacggcgcgaag
ctgggtatcgccattagcaccgttgacgggcagcactactgcgccggcgacgcccgggag
cgtttctccattcagtctatctcgaaggtgctaagcctggtggtggccatgaaccactat
caggaagaggagatctggcagcgggtggggaaggatccgtccggacagccgtttaactca
ctgctgcagctggagattgagcagggcaagccgcgtaacccctttattaatgccggtgcg
ctggtggtgtgcgatatgctgcaaagccgcctgagcgcgccgcgtcagcggatgctggaa
atcatccgcaaactttccggtgtcggtgatatcgcctatgacgcggtggtcgcccgttcg
gagttcgaccattccgcccgaaatgcggccattgcctggctaatgaaatcgttcggcaac
tttcataacgatgtcgccaccgtgctgcagaactacttccattactgcgcgctgaagatg
agctgtagcgaactggcacagacgtttctctttctggcaaaccaggggcgttcgccgcgc
cacgagcaggcgattattacgccgctgcagtcgcggcaggtgaacgcgctgatggcgacc
tgcggtatgtatcagaacgcgggtgagtttgcctggcgcgtcgggctgccggcgaaatcg
ggcgtgggcggcggtattgtggctatcgttccccatgaaatggcgattgcggtctggagc
ccgcagcttgatgaggcggggaattcgctggccggaatcgcggtactcgagcggctgacc
cagcgtcttggccgttcggtgttttga

DBGET integrated database retrieval system