KEGG   Enterobacter lignolyticus SCF1: Entcl_2525Help
Entry
Entcl_2525        CDS       T01342                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
esc01100  Metabolic pathways
esc01110  Biosynthesis of secondary metabolites
esc01130  Biosynthesis of antibiotics
esc01230  Biosynthesis of amino acids
Module
esc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Entcl_2525
Enzymes [BR:esc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Entcl_2525
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Entcl_2525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADO48775
UniProt: E3G9S2
Position
2676918..2678276
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKKIWVDARKQQQPLASFQNDIVPSSRHFYDALQGARTVFILECKKASPS
KGVIREDFDPARIAGIYKHYASAISVLTDEKYFQGSFDFLPIVSRIAPQPVLCKDFIIDP
YQIQLARYYQADACLLMLSVLDDEQYRQLAAVAHSLSMGVLTEVSNEEELERAIALGAKV
VGINNRDLRDLSIDLNRTRQLAPRLGAGVTVISESGINTYREVRELSHFANGFLIGSALM
AHDDLNAAVRRVLLGENKVCGLTRAQDAQAAYEAGALYGGLIFVPSSPRAVSEAQAREVM
RAAPLCYVGVFRNSPASEIAATVGQLGLSAVQLHGSEDQASIDALRALLPAGVQIWKALS
VGETLPARNLNHVDKYVLDNGQGGTGQRFDWSLLNGQPLSNVLLAGGLGPDNCVEAAKSG
CAGLDFNSGVESQPGIKDASKLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgttttagcgaaaattgttgccgacaaaaaaatctgggtcgacgcccgtaag
caacagcagccattagccagctttcagaatgacatcgtgccaagcagccgtcatttttac
gatgcgctgcagggcgcgcgcaccgtattcattctcgaatgcaagaaggcctcgccgtcc
aaaggcgtgatccgcgaggacttcgatccggcgcgtattgccggtatctacaagcactac
gcctccgcaatttccgtgctgaccgatgagaaatatttccagggcagcttcgattttctg
ccgatcgtcagtcgcatcgcgccgcagcccgtgctgtgcaaggactttattatcgatcct
taccagattcagctggcgcgctactaccaggccgatgcctgcctgctgatgctttcggtg
ctggacgatgagcagtaccgccagcttgccgccgtcgcccatagcctgagcatgggcgtg
ctgacggaggtcagcaatgaggaagagcttgagcgcgctatcgctctcggcgcaaaggtg
gtggggatcaacaaccgcgacctgcgcgacttgtctatcgatctcaaccgcacccgtcag
ctggcgccgcgccttggcgcaggcgttaccgtcatcagcgagtccgggatcaatacctac
cgcgaggtgcgcgagctgagccattttgctaacggctttctgattggctccgcgctgatg
gcgcatgacgatctcaacgccgccgtgcgccgcgtgctgctgggggagaacaaggtctgc
gggctgacccgcgcgcaggacgcccaggccgcctatgaggccggcgcgctctacggcggc
ctgattttcgtgccctcctcgccgcgcgcggtcagtgaagcgcaggcccgcgaggtgatg
cgcgccgcgccgctctgctacgtcggcgtctttcgcaactccccggcgtcggagattgct
gccaccgtcgggcagcttggtctgagcgcggtccagctgcacggcagcgaagaccaggcc
agtatcgatgcgcttcgcgctctgctgcccgctggcgtacaaatctggaaagcgctgagc
gtcggcgaaacgctgccggcccgcaacctcaaccacgtcgataagtacgtgctggataac
ggccagggcggcaccggccagcgcttcgactggtccctgcttaacggccagccgctgagc
aacgttttactggcaggcggtcttggccctgacaactgcgtagaagccgcaaaaagcggc
tgcgccgggctcgatttcaattcaggtgtagagtcgcaaccgggaatcaaagatgccagc
aagctggcctcggtatttcagacgctgcgcgcatattaa

DBGET integrated database retrieval system