KEGG   Enterobacter lignolyticus: Entcl_2526Help
Entry
Entcl_2526        CDS       T01342                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
esc  Enterobacter lignolyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Entcl_2526
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Entcl_2526
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Entcl_2526
Enzymes [BR:esc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Entcl_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2678286..2679479
Genome map
AA seq 397 aa AA seqDB search
MSTLLNPYFGEFGGQYVPQILMPALRQLEEAFVSAQKDPAFQAQFTDLLKNYAGRPTALT
KCQNLTTGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRVYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREYQRMIGEETKAQILEKEGRLPDAVIACVGGGSNAIGM
FADFIDEASVGLIGVEPAGHGIETGEHGAPLKHGRVGIYFGMKSPMMQTDEGQIEESYSI
SAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKALCRHEGIIPALESSHALAHALK
MMREAPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgttattaaatccctactttggtgagtttggcggccagtacgtgccgcagatc
ctgatgcccgccctgcgccagctcgaagaagccttcgtcagcgcgcaaaaggacccggcg
tttcaggcccagtttaccgacctgctgaaaaactacgccggtcgcccgacggcgctgact
aaatgtcagaacctgaccaccggcaccaacaccacgctgtacctcaagcgtgaggacctg
ctgcacggcggcgcccacaaaaccaaccaggtgctcggtcaggcgctgctggcaaaacgc
atgggcaaaacggaaatcatcgccgaaaccggggccggtcagcacggcgtcgcctcggcg
ctggccagcgccctgctcggcctgaaatgccgcgtttatatgggcgcgaaagacgttgag
cgccagtcgcctaacgtcttccgtatgcgtctgatgggcgcagaagtgatcccagtgcac
agcggttccgccacgctgaaggatgcctgcaacgaggcgctgcgcgactggtccggcagc
tatgaaacggcgcactatatgctgggcaccgcggcgggcccgcatccgtacccgaccatc
gtgcgtgagtaccagcgcatgatcggcgaagagaccaaagcgcagatcctcgaaaaagag
ggtcgtctgccggatgccgttatcgcctgcgtcggcggcggttctaacgccatcggcatg
tttgcggacttcatcgatgaggcgtcggttgggcttatcggcgtcgagcctgccggtcac
ggtattgaaaccggcgagcacggcgcgccgctgaagcatggccgcgtcggcatctatttc
ggcatgaaatcgccgatgatgcagaccgatgaaggccagattgaagagtcttactccatt
tccgccgggctcgatttcccgtccgtcgggccgcagcacgcgtacctgaacagcatcggc
cgcgccgattacgtctccattaccgacgacgaagcgctggaggcttttaaggccctgtgc
cgtcacgaggggattatcccggcgctggagtcctcccacgcgctcgctcatgccctgaaa
atgatgcgcgaggccccggaaaaagagcagctgctggtggttaacctgtccggtcgcggc
gataaagacatcttcaccgtacacgatattctgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system