KEGG   Enterobacter lignolyticus: Entcl_2527Help
Entry
Entcl_2527        CDS       T01342                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
esc  Enterobacter lignolyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Entcl_2527
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Entcl_2527
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Entcl_2527
Enzymes [BR:esc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Entcl_2527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2679479..2680288
Genome map
AA seq 269 aa AA seqDB search
MERYDNLFAQLKARREGAFVPFVTLGDPTPEQSLNIIDTLIDAGADALELGIPFSDPLAD
GPTIQSATLRAFAAGVTPTQCFELLAAIRQKHPTIPIGLLMYANLVFNRGIDEFYATCAR
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNADDELLRQIASHGRGYTYLLSRA
GVTGAENRAALPLHHLIDKLTEYHAAPPLQGFGISSPDQVAAAIGAGAAGAISGSAIVKI
IEKHVGNHPAMLAELKAFVQAMKAVTRSA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctatgacaacctgtttgcacaactgaaagctcgccgggaaggcgcgtttgtt
cccttcgtgacgctcggcgatccgacgccggaacagtcgctcaacatcattgacaccctg
atcgacgcgggcgccgatgcgctggagctgggcatccccttctccgacccgctggcggat
gggccgacgattcagagcgccacgctgcgcgcctttgccgcaggggtgacgccgacccag
tgcttcgagctgctggcggctattcgtcaaaagcatccgaccattcccatcggcctgctg
atgtacgccaacctggtatttaaccgcggtatcgacgagttttacgccacatgcgcccgc
gtgggcgtcgactcggtgctggtggccgacgtgccggtggaagagtccgcaccgttccgt
caggcggcgatgcgccataacgtggcgccgatcttcatctgcccgccaaacgccgatgac
gagctgctgcgccagattgcctcgcacggtcgcggctacacctatctgctctcccgtgcg
ggcgtcaccggcgcggagaaccgcgccgccctgccgctgcaccatctgatcgataagctc
accgaataccatgccgcgccgccgctgcagggcttcggcatctcctcgcccgatcaggtc
gcagccgccatcggcgcaggcgcggcgggcgcgatttccggctccgcaatcgtcaagatt
atcgagaaacatgtcggtaatcatccggcgatgctggccgagctgaaagccttcgttcag
gcgatgaaggcggtaacccgcagcgcgtga

DBGET integrated database retrieval system