KEGG   Enterobacter lignolyticus: Entcl_2561Help
Entry
Entcl_2561        CDS       T01342                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
esc  Enterobacter lignolyticus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Entcl_2561
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Entcl_2561
Enzymes [BR:esc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Entcl_2561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2710854..2711336
Genome map
AA seq 160 aa AA seqDB search
MTTFYQLTATSLRGQLITMADYAGKLVIVVNTASHCGFTPQYAGLEALYQKYAAQGLVVL
GFPCNQFGKQEPGDADEISQTCHITYGVSFPMFEKVEVNGAATHPVFRYLKDELPGVLGG
RIKWNFTKFLIGRDGKPLKRFAPFTTPEKMEAAILAALKI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccactttttatcaactgacggccaccagtctacgtggccagctcatcactatggcc
gactacgctggcaaactggttatcgtggttaataccgccagtcattgtggcttcacgcca
caatatgcaggcctggaagcgctctaccagaagtacgcagcccaggggctggtggttctt
ggtttcccctgcaaccagttcgggaagcaggaacccggcgacgccgacgaaatttcgcag
acctgccacatcacctacggtgtgagcttcccaatgttcgagaaagtggaggtcaacggt
gctgccacccacccggtgtttcgttacctgaaagacgaattgcccggcgtgctgggtggt
cggatcaaatggaacttcactaagttcctgatcgggcgcgacggcaaaccgctcaagcgt
tttgccccgttcaccaccccagagaaaatggaagccgcaatccttgctgcacttaaaatc
taa

DBGET integrated database retrieval system