KEGG   Enterobacter cloacae SCF1: Entcl_3004Help
Entry
Entcl_3004        CDS       T01342                                 

Definition
glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
esc  Enterobacter cloacae SCF1
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:esc00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3202512..3203885)
Genome map
AA seq 457 aa AA seqDB search
MNALPAGFLWGNSVSSMQTEGAWNEGGKGMSVYDIREPGEFTSDWKVATDSYHRYQQDFD
LMKDLGMNCYRFQISWSRVCPTGDGEFNEEGIAFYHRFIDDLIARGIEPMICLYHFDMPL
HLAQTYNGFTDRRVMEAFVRYGQKMIDCYGDKVKWWLTFNEQNLYHMPEAFRISGYMRGE
QTLRDLYAIQHHVMMAHAHLTDYLHQHKPGQLMGGMLAHALVYPATCKPRDIFCAQQVDE
FFNQNLLRVFAGEGYSPEVMALVEREGFRCLYRDEDLALLAQIKNDYLAFSYYASRSLDS
DAIPPDTAVNNYMLYGDKRNPYLQATEWSWQIDPLGFRTIITRYYNDWRLPVFPIENGIG
VIERWDGVNPVEDDYRIAYHRDHINAMKDAMFEDGAQVIGYLGWGLIDILSSQGDMRKRY
GVVYVNRENHDLKDLKRVPKKSYAWLKRAIHSNGEAL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcattgccagcaggatttttatggggcaactcggtttccagtatgcagaccgaa
ggcgcgtggaatgagggaggaaagggaatgtcggtctacgatattcgcgaacccggcgag
tttacctccgactggaaggtggccaccgattcgtaccaccgctatcagcaggatttcgac
ctgatgaaagatctcgggatgaactgctaccgctttcagatatcctggagccgcgtctgt
ccgaccggcgacggtgagttcaatgaagagggtatcgcattttatcaccgcttcatcgac
gacctgatcgcccgcggcattgaaccgatgatctgcctgtaccacttcgatatgccgctg
caccttgcacaaacctacaacggttttaccgatcgccgggtcatggaggcgtttgtccgc
tacggccagaagatgatcgactgctacggcgacaaagtgaaatggtggctgacctttaac
gaacagaacctttaccacatgccggaggcgtttcgtatttccggttatatgcgcggagaa
caaaccctgcgcgacctttacgccatccagcaccacgtgatgatggcccacgcccatctg
accgattatctgcatcagcacaagccgggacagctgatgggcggcatgctggcgcatgcg
ctggtctacccggcgacctgtaagccgcgggacatcttttgcgcccagcaggtcgatgaa
ttctttaaccagaacctgctgcgggtattcgctggcgaaggatacagcccagaggtcatg
gcgctggtcgagcgcgaaggtttccgctgcctgtatcgcgatgaggatctggcgctactg
gcgcagatcaaaaacgactatcttgcgtttagctactatgccagcagatctctcgacagc
gacgcgattccacccgataccgcagtcaacaactacatgctgtatggcgataaacgcaac
ccgtatctgcaggcgaccgaatggagctggcagatagatccgctgggttttcgcaccatt
atcacccgctattacaacgactggcggctgccggtgttccccatcgagaacggcatcggg
gtgattgagcgctgggatggcgttaatccggtggaggatgattaccgcattgcgtaccac
cgcgatcatatcaacgccatgaaggacgccatgtttgaggatggcgctcaggttatcggc
tatctcggctgggggcttatcgacattctcagctcacagggcgatatgcgtaagcgctac
ggcgtggtttacgttaaccgcgaaaaccatgacctgaaagatcttaagcgcgtgccgaag
aagagctacgcgtggttaaaacgggcgattcacagcaacggcgaagcgctgtaa

DBGET integrated database retrieval system