KEGG   Enterobacter lignolyticus: Entcl_3059Help
Entry
Entcl_3059        CDS       T01342                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
esc  Enterobacter lignolyticus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Entcl_3059
   00500 Starch and sucrose metabolism
    Entcl_3059
Enzymes [BR:esc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Entcl_3059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3260341..3261624
Genome map
AA seq 427 aa AA seqDB search
MNISSVSRLALALAFGVTLTACSSTPADQRPSTQAAPGTASRPILSAAEAKNFVQSRYFT
TMDANAAPWSPSAIATPAKPDFVVGPAGAQGVTHTTIQAAIDAAIARHSDQRLYIAILPG
DYPGTVYIPAAPGSLTLYGTGDKAADVKIGLAIDSEIDPNSWRRLVNPGGKYMPGKPAWY
MFDSCQSKRSATVGVMCSAVVWSQNNGLQLQNLTIENNLGDSVDAGNHQAVALRSDGDQV
QINNVNILGRQNTFFVTNSGVQNRLQNDRITRTLVTNSYLEGDVDIVSGRGAVVFDNTDF
RVVNSRTQKEGYVFAPATPSNLTFGFLATNSRFNAAGDGVAQLGRSLDVDSSTNGQVVIR
DSVINEGFNMAKPWANAAISGRPFSGNTGAKDDKGEIQRNLNDTNFNRMWEYNNRGTGSY
VAAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacatatcatcggtttcccgtctggcgctggcgctcgcttttggcgtgacactgacc
gcctgcagctctacccccgcggatcaacgcccgtcgactcaggcggcgccgggaacagct
tcccgcccaatcctttctgctgctgaagcgaaaaacttcgttcagtcgcgctatttcacc
accatggatgccaatgccgcgccgtggtcgccttccgctatcgcgacgcctgcgaaaccc
gactttgtggtcggcccggcgggcgctcagggcgtgacgcatacgacgattcaggcggcg
attgatgccgctatcgcccgccacagcgaccagcgtctttatatcgccattctgccaggc
gactacccaggcaccgtgtatatccctgccgcgcctggcagcctgacgctctacggcacc
ggcgataaggccgctgatgtaaaaatcggcctggctatcgattctgaaatcgatccgaac
agctggcgtcgtctggtgaacccgggcggtaaatatatgcctggcaaaccggcgtggtac
atgtttgacagctgccagagcaaacgcagcgccaccgtcggcgtcatgtgctcagccgtc
gtctggtcgcagaacaacggcctgcagctgcagaatctgaccattgagaacaacctcggc
gacagcgttgacgccggtaaccaccaggcggtagcgctgcgcagcgacggcgaccaggtg
cagatcaacaacgtcaatattctcggtcgtcagaacaccttcttcgtcaccaacagcggc
gtacagaaccgtctgcaaaacgatcgcatcacccgcacgctggtcaccaacagctacctt
gaaggggatgtggatatcgtttccggccgcggcgcggtagtgttcgataacactgacttc
cgcgtggtgaattcgcgtacccagaaagaaggctacgtgttcgcgccagccaccccgtcc
aacctgaccttcggtttcctggccactaacagccgctttaacgccgcaggcgacggcgtc
gctcagcttggccgttctctggatgtggacagcagcaccaacggccaggtggttattcgc
gacagcgtgattaacgagggcttcaacatggcaaaaccgtgggccaacgcggcaatctcc
gggcgtccgtttagcggcaacaccggcgcgaaagacgacaaaggcgagatccagcgcaac
ctcaacgacacgaacttcaaccgcatgtgggaatacaacaaccgcggtacaggaagctac
gtggcggctgagccgaagcagtaa

DBGET integrated database retrieval system