KEGG   Enterobacter lignolyticus SCF1: Entcl_3074Help
Entry
Entcl_3074        CDS       T01342                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00010  Glycolysis / Gluconeogenesis
esc00052  Galactose metabolism
esc01100  Metabolic pathways
esc01110  Biosynthesis of secondary metabolites
esc01120  Microbial metabolism in diverse environments
esc01130  Biosynthesis of antibiotics
Module
esc_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entcl_3074
   00052 Galactose metabolism
    Entcl_3074
Enzymes [BR:esc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Entcl_3074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADO49320
UniProt: E3G3R4
Position
3276203..3277243
Genome map
AA seq 346 aa AA seqDB search
MLTDNSTLAPDGQPWRLLTLRNGAGMVVTLMDWGATLLSAQVPLNDGSLREALLGCAGPE
QYPQQAAFLGASVGRYANRIADSRYTLSGEVVTLSPSQGVNQLHGGPEGFDKRRWQIVSH
SDNSVLFALESSDGDQGFPGNLRATARYQLTDDNRISIEYRATVDKPCPVNMTNHVYFNL
DGEQTDVRNHRLQIFAQQYLPVDETGIPRAGLKNVAGTSFDFRDAKAIAREFLSDADQRK
TKGYDHAFLLSAAGDVQQPAAIVCSADGRLQLKVMTSAPALQFYSGNYLGGTPSRSGGTY
ADWQGLALESEFLPDSPNHPEWPQPDCILRPGAEYVSLTEYQFIAL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgctgactgataactccacgctggcccctgacggccagccctggcgactgctcaccctg
cgcaacggcgccggaatggtcgtcacgctgatggactggggcgcgaccctgctgtccgcg
caggtgccgcttaacgacggcagtcttcgcgaggcgctgcttggctgcgccggtcctgaa
cagtatccgcagcaggcggcgtttctcggcgcgtcggtcggccgctatgccaaccgtatc
gccgacagccgctacacgctttcgggcgaggtcgtcacgctgtcgcctagccagggcgtc
aaccagctgcacggcgggccggaggggtttgacaaacgccgctggcaaatcgtcagccac
agcgacaacagcgtgctgttcgcgctggagtcttccgacggcgaccagggttttcccggc
aatctgcgcgctacggcccgctatcagctgaccgacgataaccgcatcagcatcgaatac
cgcgcgaccgtcgataagccctgcccggtgaacatgaccaaccacgtctatttcaacctg
gacggcgagcagaccgacgtacgtaatcaccgcctgcagatttttgcgcagcagtatctg
ccggtcgatgaaacggggatcccgcgcgcgggcctgaagaatgtcgcgggcaccagcttt
gattttcgcgatgccaaagccatcgcccgggagttcctcagcgacgccgatcagcgtaaa
accaaaggctacgatcacgcgtttctgctcagcgccgcaggcgatgtgcagcagcccgcc
gcgatcgtctgctcggcggacggcaggctgcagcttaaggtgatgacctccgcccccgcg
ctgcagttctactccggcaactatctgggcggcacgccttcccgcagcggcggcacctat
gccgactggcaggggctggcgctggaaagcgagtttctccccgacagcccgaatcacccc
gaatggccccagcctgactgcattttgcggcctggcgcggagtacgtcagcctcaccgaa
taccagtttatcgcactgtga

DBGET integrated database retrieval system