KEGG   Enterobacter lignolyticus: Entcl_3075Help
Entry
Entcl_3075        CDS       T01342                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
esc  Enterobacter lignolyticus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Entcl_3075
   01230 Biosynthesis of amino acids
    Entcl_3075
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entcl_3075
  Energy metabolism
   00680 Methane metabolism
    Entcl_3075
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Entcl_3075
Enzymes [BR:esc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Entcl_3075
Exosome [BR:esc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Entcl_3075
  Exosomal proteins of melanoma cells
   Entcl_3075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3277451..3278203
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKDEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
ITPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtgcgccacggcgaaagccagtggaacaacgaaaac
cgtttcaccggttggtacgacgttgatctgtcagagaaaggcgttagcgaagcgaaagcg
gcgggcaaactgctgaaagacgaaggcttcagcttcgattttgcttatacctctgtgctg
aaacgtgccatccacacgctgtggaacgtactggatgaactggaccaggcctggctaccg
gtggagaaatcctggaaactgaacgagcgccactacggcgcgctgcagggtctgaacaaa
gcagaaaccgcagaaaaatatggcgatgagcaggtgaaacagtggcgtcgcggcttcgcg
ataaccccgccggagctgacgaaagacgacgaacgctacccgggacacgacccgcgctat
gcgaaactgaccgacgcagagctgccaaccaccgaaagcctggcgctgaccatcgatcgc
gttgtgccgtactggaacgaaaccattctgccgcgcctgaaaagcggcgagcgcgtgatc
atcgccgcgcacggcaactccctgcgcgcgctggtgaaatacctggacaacatgggtgaa
gacgagatcctcgaactgaatattccgaccggcgtgccgctggtttatgagttcgacgag
aacttcaaaccgcttaaacgctattacctgggcaacgccgacgaaatcgccgcaaaagcc
gccgccgtcgcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system