KEGG   Enterobacter lignolyticus SCF1: Entcl_3075Help
Entry
Entcl_3075        CDS       T01342                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00010  Glycolysis / Gluconeogenesis
esc00260  Glycine, serine and threonine metabolism
esc00680  Methane metabolism
esc01100  Metabolic pathways
esc01110  Biosynthesis of secondary metabolites
esc01120  Microbial metabolism in diverse environments
esc01130  Biosynthesis of antibiotics
esc01200  Carbon metabolism
esc01230  Biosynthesis of amino acids
Module
esc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
esc_M00002  Glycolysis, core module involving three-carbon compounds
esc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entcl_3075
  Energy metabolism
   00680 Methane metabolism
    Entcl_3075
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Entcl_3075
Enzymes [BR:esc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Entcl_3075
Membrane trafficking [BR:esc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Entcl_3075
Exosome [BR:esc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Entcl_3075
  Exosomal proteins of melanoma cells
   Entcl_3075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADO49321
UniProt: E3G3R5
Position
3277451..3278203
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKDEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
ITPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtgcgccacggcgaaagccagtggaacaacgaaaac
cgtttcaccggttggtacgacgttgatctgtcagagaaaggcgttagcgaagcgaaagcg
gcgggcaaactgctgaaagacgaaggcttcagcttcgattttgcttatacctctgtgctg
aaacgtgccatccacacgctgtggaacgtactggatgaactggaccaggcctggctaccg
gtggagaaatcctggaaactgaacgagcgccactacggcgcgctgcagggtctgaacaaa
gcagaaaccgcagaaaaatatggcgatgagcaggtgaaacagtggcgtcgcggcttcgcg
ataaccccgccggagctgacgaaagacgacgaacgctacccgggacacgacccgcgctat
gcgaaactgaccgacgcagagctgccaaccaccgaaagcctggcgctgaccatcgatcgc
gttgtgccgtactggaacgaaaccattctgccgcgcctgaaaagcggcgagcgcgtgatc
atcgccgcgcacggcaactccctgcgcgcgctggtgaaatacctggacaacatgggtgaa
gacgagatcctcgaactgaatattccgaccggcgtgccgctggtttatgagttcgacgag
aacttcaaaccgcttaaacgctattacctgggcaacgccgacgaaatcgccgcaaaagcc
gccgccgtcgcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system