KEGG   Enterobacter lignolyticus: Entcl_3100Help
Entry
Entcl_3100        CDS       T01342                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
esc  Enterobacter lignolyticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Entcl_3100
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Entcl_3100
  Amino acid metabolism
   00310 Lysine degradation
    Entcl_3100
Enzymes [BR:esc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Entcl_3100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3306108..3307313)
Genome map
AA seq 401 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGTTVTSRQILGRLREGNSAGKETSAKADAKESTPAQRQQASLEEQSNDALSPAIRR
LLAEHSLDASAIKGTGVGGRITREDVEKHLAKAPAKAAAAPAPVAPLAGRSEKRVPMTRL
RKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDAFEKRHGIRLGFMSFYVKAVVE
ALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDALGMADIEKNIKELAV
KGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVDGKVEI
LPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLDV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgagtctgttgccgatgcgacggtg
gcaacctggcacaaaaaaccgggtgatagtgtccagcgtgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcgtctgctgacggcattctggatgcagtg
ctggaagatgaagggactaccgtgacctctcgtcagattctgggccgcctgcgtgaaggc
aacagcgccggtaaagaaaccagcgcgaaagccgatgcgaaagagtctaccccggctcag
cgtcagcaggcttctcttgaagagcagagcaacgatgcgctcagcccggcgattcgtcgc
ctgctggccgaacacagcctcgacgccagcgctatcaaaggcaccggcgtgggcggtcgt
atcacccgtgaagatgttgagaagcatctggcgaaagcgcctgcaaaagcggcagccgca
ccggctccggtagcgccgctggcgggccgcagcgaaaaacgcgtgccgatgacccgtctg
cgtaagcgcgtcgctgagcgtctgctggaagcgaaaaactccaccgccatgctgacgacc
ttcaacgaagtcaacatgaagcccatcatggatctgcgcaagcagtacggcgacgcgttt
gaaaaacgtcacggtatccgcctgggctttatgtctttctacgtgaaagccgtagttgaa
gcgctgaaacgctatccggaagtcaacgcctctatcgatggcgacgacgtggtgtaccac
aactacttcgacgtcagcatggcggtctctacgccgcgcggcttggtaaccccggtactg
cgtgacgttgacgcgctcggcatggccgacatcgagaaaaacattaaggaactggcggtg
aaaggccgtgacggtaagctgaccgttgacgatctgaccggtggtaacttcaccatcacc
aacggtggtgtttttggttccctgatgtctacgccgatcatcaacccgccgcagagcgcg
atcctcggcatgcacgccatcaaagatcgcccgatggcggtcgacggcaaagtcgaaatc
ctgccgatgatgtacctggcgctgtcttacgaccaccgtctgatcgacggccgcgagtcc
gtgggcttcctggtagcgattaaagagctgctggaagatccgactcgtctgctgctggac
gtgtag

DBGET integrated database retrieval system