KEGG   Enterobacter lignolyticus SCF1: Entcl_3104Help
Entry
Entcl_3104        CDS       T01342                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00020  Citrate cycle (TCA cycle)
esc00190  Oxidative phosphorylation
esc00650  Butanoate metabolism
esc01100  Metabolic pathways
esc01110  Biosynthesis of secondary metabolites
esc01120  Microbial metabolism in diverse environments
esc01130  Biosynthesis of antibiotics
esc01200  Carbon metabolism
Module
esc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
esc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
esc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Entcl_3104
   00650 Butanoate metabolism
    Entcl_3104
  Energy metabolism
   00190 Oxidative phosphorylation
    Entcl_3104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADO49350
UniProt: E3G3U4
Position
complement(3312874..3313221)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATTGTVTWEVWTGFFSSSFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLAVRLVLQLAIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctcggcattaggacgcaacggcgtacatgacttcattctggttcgt
gccactgcgatcgttctgaccctgtacatcatctacatggttggctttttcgcgacgacc
ggcaccgtgacctgggaagtctggacgggctttttctcttcctctttcaccaaagttttc
accctgctggcgctcttttccatcttgattcacgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggccgtgcgccttgtgctgcagctggctatcgttgttgcg
ctggtggtttacgtcatttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system