KEGG   Enterobacter lignolyticus SCF1: Entcl_3189Help
Entry
Entcl_3189        CDS       T01342                                 

Definition
(GenBank) Acireductone dioxygenase (Fe(2+)-requiring)
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00270  Cysteine and methionine metabolism
esc01100  Metabolic pathways
Module
esc_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Entcl_3189
Enzymes [BR:esc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Entcl_3189
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Entcl_3189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ADO49435
UniProt: E3G4P1
Position
3404268..3404810
Genome map
AA seq 180 aa AA seqDB search
MSALTIFSDNDASQPTWHGTDAQKIARQLSAKGVRFERWQADQALGDNPTPDAVLAAYQH
AIATLVAEKGYQSWDVISLRADNPQKAALREKFLSEHTHGEDEVRFFVEGAGLFCLHIGN
EVYQVLCEKNDLISVPAGTPHWFDMGSEPNFTAIRVFDNPEGWIAQFTGSSIADGYPRLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcactgacgattttttccgataatgacgccagccagccgacctggcacggtacc
gacgcccagaaaatcgcccggcagctcagcgccaaaggcgtgcgctttgagcgctggcag
gcggaccaggctctcggcgataacccgacgccggacgccgtgctcgcggcttatcagcac
gctattgccacactggtggcggaaaaaggctatcagagctgggacgttatcagcctgcgc
gccgacaacccgcagaaagcggcgctgcgcgagaagttcctgagcgaacatacccacggc
gaagacgaggtgcgcttcttcgtggagggcgcaggtcttttttgcctgcatatcggcaac
gaggtgtatcaggtgctgtgtgagaaaaatgacctgatctccgtcccggcgggcaccccg
cactggtttgatatggggtctgaaccgaactttaccgcaattcgcgttttcgataacccc
gaaggctggatagcgcagtttaccggcagcagtattgcggacggctacccgcgcctggcg
tga

DBGET integrated database retrieval system