KEGG   Enterobacter lignolyticus: Entcl_3271Help
Entry
Entcl_3271        CDS       T01342                                 

Definition
glycoside hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
esc  Enterobacter lignolyticus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Entcl_3271
  Lipid metabolism
   00561 Glycerolipid metabolism
    Entcl_3271
   00600 Sphingolipid metabolism
    Entcl_3271
Enzymes [BR:esc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Entcl_3271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3491748..3493100
Genome map
AA seq 450 aa AA seqDB search
MRPPKITFIGAGSTIFVKNILGDVFQRPALKTAHIALMDIDPVRLEESHIVVRKLMESAD
ATGSITCHSSRKEALRDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGIM
RALRTIPHLWQICEDMTEVCPNATMLNYVNPMAMNTWAMYARYPQIKQVGLCHSVQGTAE
ELARDLDISADTLRYRCAGINHMAFYLSLEKKGENGEYTSIYPDLLRAYENGHAPKPNSH
SNSRCQNIIRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLINRYKVPLDEYPKRCVE
QLANWRNELEAYKTAERIEIKPSREYASTIMNAIWTGEPSVIYGNVRNEGLIDNLPQGCC
VEVPCLVDSNGLQPTKIGALPSHLAALMQTNINVQTLLTEAMLTENRERVYHAALLDPHT
AAVLSIEEIYTLMDDLIAAHGDWLPEWVHP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcggccccctaaaattacctttatcggcgcaggttccaccatttttgtgaagaatatt
ctcggcgacgtatttcagcgcccggcactgaaaacagcgcatatcgccctgatggacatt
gaccctgtacggctggaagagtctcacattgtcgtacgtaaactgatggagtctgccgac
gcgacgggcagcatcacctgtcatagttcccgcaaagaggcgcttcgcgatgccgatttt
gtcgtcgtggcatttcagataggcggctatgaaccctgtaccgtgactgattttgaagtt
tgtaaacgacatggtctggaacagacaatagcggatacgctgggcccaggcggcatcatg
cgcgccctgcggacgatcccgcatttgtggcaaatttgtgaggacatgacggaggtttgt
ccaaatgccaccatgcttaattacgttaacccgatggcgatgaatacctgggcaatgtac
gccagatacccgcagattaaacaggttgggttgtgtcattccgtacagggaacagcagag
gaactggctcgtgacctggatatttctgctgacaccttacgctaccgctgcgccggtatt
aatcatatggcgttttatttgtcgctggagaaaaaaggggaaaatggcgaatacaccagc
atctaccccgatttattacgtgcttatgaaaacggccatgcgcctaaaccgaattctcac
agtaactcacgctgtcagaacattatccgctacgagatgtttaagaaactgggctacttt
gtcacagagtcttctgaacattttgccgaatacacgccgtggttcattaaaccgggtcgt
gaagatttgattaatcgctacaaggtgcctctggacgaatatccgaagcgctgtgtagag
caactggctaactggcgcaatgagcttgaagcgtacaaaacggcagagcgcatcgagatt
aagccttcccgcgaatatgccagcactattatgaacgcaatctggaccggcgaacccagc
gttatttatggcaacgtgcgcaacgaggggttaattgataacctgccgcagggatgctgc
gtggaggtcccttgtctggtcgacagcaacgggcttcagcccaccaaaataggcgctctg
ccctcacatcttgccgcgctgatgcaaaccaacatcaacgttcagacgctattaactgag
gcgatgctgactgaaaaccgggagcgcgtttaccatgccgcgctgctggatccacacacg
gcggcagtgctcagcattgaggaaatctatacgctgatggacgatttgatagcagctcat
ggcgactggttacctgagtgggtacacccgtaa

DBGET integrated database retrieval system