KEGG   Enterobacter cloacae SCF1: Entcl_3271Help
Entry
Entcl_3271        CDS       T01342                                 

Definition
glycoside hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
esc  Enterobacter cloacae SCF1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:esc00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:esc00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:esc00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3491748..3493100
Genome map
AA seq 450 aa AA seqDB search
MRPPKITFIGAGSTIFVKNILGDVFQRPALKTAHIALMDIDPVRLEESHIVVRKLMESAD
ATGSITCHSSRKEALRDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGIM
RALRTIPHLWQICEDMTEVCPNATMLNYVNPMAMNTWAMYARYPQIKQVGLCHSVQGTAE
ELARDLDISADTLRYRCAGINHMAFYLSLEKKGENGEYTSIYPDLLRAYENGHAPKPNSH
SNSRCQNIIRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLINRYKVPLDEYPKRCVE
QLANWRNELEAYKTAERIEIKPSREYASTIMNAIWTGEPSVIYGNVRNEGLIDNLPQGCC
VEVPCLVDSNGLQPTKIGALPSHLAALMQTNINVQTLLTEAMLTENRERVYHAALLDPHT
AAVLSIEEIYTLMDDLIAAHGDWLPEWVHP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcggccccctaaaattacctttatcggcgcaggttccaccatttttgtgaagaatatt
ctcggcgacgtatttcagcgcccggcactgaaaacagcgcatatcgccctgatggacatt
gaccctgtacggctggaagagtctcacattgtcgtacgtaaactgatggagtctgccgac
gcgacgggcagcatcacctgtcatagttcccgcaaagaggcgcttcgcgatgccgatttt
gtcgtcgtggcatttcagataggcggctatgaaccctgtaccgtgactgattttgaagtt
tgtaaacgacatggtctggaacagacaatagcggatacgctgggcccaggcggcatcatg
cgcgccctgcggacgatcccgcatttgtggcaaatttgtgaggacatgacggaggtttgt
ccaaatgccaccatgcttaattacgttaacccgatggcgatgaatacctgggcaatgtac
gccagatacccgcagattaaacaggttgggttgtgtcattccgtacagggaacagcagag
gaactggctcgtgacctggatatttctgctgacaccttacgctaccgctgcgccggtatt
aatcatatggcgttttatttgtcgctggagaaaaaaggggaaaatggcgaatacaccagc
atctaccccgatttattacgtgcttatgaaaacggccatgcgcctaaaccgaattctcac
agtaactcacgctgtcagaacattatccgctacgagatgtttaagaaactgggctacttt
gtcacagagtcttctgaacattttgccgaatacacgccgtggttcattaaaccgggtcgt
gaagatttgattaatcgctacaaggtgcctctggacgaatatccgaagcgctgtgtagag
caactggctaactggcgcaatgagcttgaagcgtacaaaacggcagagcgcatcgagatt
aagccttcccgcgaatatgccagcactattatgaacgcaatctggaccggcgaacccagc
gttatttatggcaacgtgcgcaacgaggggttaattgataacctgccgcagggatgctgc
gtggaggtcccttgtctggtcgacagcaacgggcttcagcccaccaaaataggcgctctg
ccctcacatcttgccgcgctgatgcaaaccaacatcaacgttcagacgctattaactgag
gcgatgctgactgaaaaccgggagcgcgtttaccatgccgcgctgctggatccacacacg
gcggcagtgctcagcattgaggaaatctatacgctgatggacgatttgatagcagctcat
ggcgactggttacctgagtgggtacacccgtaa

DBGET integrated database retrieval system