KEGG   Enterobacter lignolyticus: Entcl_3300Help
Entry
Entcl_3300        CDS       T01342                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
esc  Enterobacter lignolyticus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Entcl_3300
Enzymes [BR:esc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Entcl_3300
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Entcl_3300
Lipid biosynthesis proteins [BR:esc01004]
 Fatty acid synthase
  Component type
   Entcl_3300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3522499..3523092
Genome map
AA seq 197 aa AA seqDB search
MPFLFLVLLTCRAAFADTVLVLGDSLSAGYRMAANAAWPALLNAKWQPKTDVINASISGD
TSQQGLARLPELLKQHQPRWVLVELGGNDGLRGFPPQQTEATLRAILKDIEAANAKPLLM
QIRLPANYGRRYNASFSAIYPKLASEFNIPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPF
IADWMATRLAPLVNHDS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgcctttcctgttcctggttctgttaacctgccgcgccgcgtttgccgacaccgttctg
gtgttaggcgacagcctcagcgccggttaccgcatggcggccaatgccgcatggcccgcg
ctgcttaacgccaaatggcagccgaaaaccgacgtcatcaacgccagcatcagcggggac
acctcacagcaggggctggcgcgcctgccggagctgctaaagcagcatcagccccgctgg
gtgctggtggagcttggcggcaacgacggcctgcgcggctttccgccgcagcagacggaa
gcgacgctgcgcgccatccttaaggatatcgaagccgccaacgccaaaccgctgctgatg
caaattcggctcccggcgaactatggtcgccgttataatgcctcttttagcgcgatatat
ccgaagctcgccagcgaatttaatattccactgctccctttcttcatggaagaagtctat
ctgaaaccgcagtggatgcaggatgatggtattcaccccaatcgtgacgcacagccgttc
attgccgactggatggcgacacgcctggctcccttagttaatcacgactcctga

DBGET integrated database retrieval system