KEGG   Enterobacter lignolyticus: Entcl_3441Help
Entry
Entcl_3441        CDS       T01342                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
esc  Enterobacter lignolyticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Entcl_3441
Enzymes [BR:esc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Entcl_3441
Exosome [BR:esc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Entcl_3441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3670020..3670994
Genome map
AA seq 324 aa AA seqDB search
MTNLIDRPRRLRKSAALRAMFEETTLTLNDLVLPIFVEEEIDDYKAIEAMPGVMRIPEKH
LAREIERIANAGIRSVMTFGISHHTDATGSDAWKEDGLVARMSRICKQTVPEMVVMSDTC
FCEYTSHGHCGVLCDHGVDNDATLVNLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPLNRREAIRESLLDEAQG
ADCLMVKPAGAYLDILRDIRERTELPLGAYQVSGEYAMIKFAAMAGAIDEEKVVLESLGA
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacttgatcgatcgtccccgccgcctgcgcaaatccgctgcgctgcgcgccatg
tttgaagagacaacgctgaccttaaacgatctggtgttgcctatttttgttgaagaagaa
atcgatgactacaaggccatcgaagcgatgccgggcgttatgcgcattcctgaaaagcac
ctggcgcgcgagattgaacgcatcgccaacgccggaatccgctcggtaatgacctttggt
atttcgcaccacaccgacgccaccggcagcgacgcctggaaagaggatgggctggtcgcg
cggatgtcgcgcatctgcaaacagaccgtgccggaaatggtggtgatgtcagatacctgc
ttttgcgaatacacctctcacggccactgcggcgtgctgtgcgatcacggcgtcgataac
gacgctaccctggtaaacctcggcaaacaggccgtggtggccgccgccgccggtgcggat
tttatcgccccctccgcggcgatggacggtcaggtgcaggcgattcgccaggcgctggat
gcggcaggttttaccgataccgccatcatgtcctactccaccaagttcgcctcctccttc
tacggcccgttccgtgaagcggcgggcaccgcgctgaaaggcgaccgcaagacctatcag
atgaacccgctgaaccgccgtgaggcgatccgcgagtcgctgctggatgaagcccagggc
gcagactgcctgatggtcaaaccggctggcgcctatctggatattctgcgcgacatccgc
gaacgtaccgaactgccgctgggcgcctatcaggtgagcggcgagtacgcgatgatcaaa
ttcgccgccatggcgggcgccattgatgaagagaaagtggttctggaaagcctgggcgcg
attaagcgtgccggcgcggatcttatcttcagctacttcgcgctggatctggccgagaaa
aaaatcctgcgctga

DBGET integrated database retrieval system