KEGG   Enterobacter lignolyticus: Entcl_3592Help
Entry
Entcl_3592        CDS       T01342                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
esc  Enterobacter lignolyticus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Entcl_3592
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Entcl_3592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3852651..3853130
Genome map
AA seq 159 aa AA seqDB search
MTRVWIAIGSNLASPLEQVNAAIRALGEIPQSRVVAVSSFYRTPPLGPQDQPDYLNAAVA
LDTALDAHTLLDHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDEVIRTGRLTVPHYDMK
NRGFMLWPLFEIAPDLRFPDGSELSILLQQLDSAQPAHW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgtctggatcgccatcggcagcaatctcgcctcaccgcttgagcaggttaac
gctgctattcgcgcgctgggcgagatcccgcagagccgggtcgtggcggtatcctcgttt
tatcgtacgccgccgctggggccgcaggatcagcccgactacctcaatgccgcggtggct
ctcgacaccgcccttgacgcgcacaccctgctcgaccatacccagcgtatcgaattgcag
caggggcgcgtgcgtaaagccgagcgctgggggccgcgcactctcgatctcgacattatg
ctgttcggcgatgaggtgatacgcaccgggcgcctgaccgtgccgcattacgacatgaaa
aaccgcggctttatgctgtggccgctgtttgaaattgctccagatttacgttttcctgac
gggagcgaactgagcatcctgctgcaacaacttgatagcgcacaacctgcccattggtaa

DBGET integrated database retrieval system