KEGG   Enterobacter cloacae SCF1: Entcl_3613Help
Entry
Entcl_3613        CDS       T01342                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
esc  Enterobacter cloacae SCF1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:esc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:esc00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:esc00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:esc00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3875117..3876991)
Genome map
AA seq 624 aa AA seqDB search
MAIEINVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVS
VGDKTETGKLIMIFDSAEGAAAAAPAQEEKKAAAPAAAPAAAAAKDVHVPDIGGDEVEVT
EILVKVGDTVSAEQSLITVEGDKASMEVPAPFAGTVKEIKVNTGDKVSTGSLIMVFEVAG
AAPAAAPVQAAAPAAAAPAASGPKEVHVPDIGGDEVEVTEVMVKVGDKIAAEQSLITVEG
DKASMEVPAPFAGTVKEIKISTGDKVSTGSLIMVFEVEGAAPAAAAPAPAAAPAQAAKSA
AAPTAKAEGKSEFAENDAYIHATPLIRRLAREFGVNLAKVKGTGRKGRILREDVQAYVKD
AVKRAEAAPAAATGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIPHV
THFDKTDITDLEAFRKQQNAEAEKRKLDVKFTPVVFIMKAVAAALEQMPRFNSSLSEDGQ
RLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELTVISKKARDGKLTAGEMQGG
CFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFMPRLMMPISLSFDHRVI
DGADGARFITIINNMLSDIRRLVM
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaatgtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtgggcgacaaagttgaagctgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagtgccgtctccgcaggctggcatcgttaaagagatcaaagtctct
gttggcgataaaaccgagaccggcaaactgatcatgattttcgattccgccgagggtgca
gcagccgctgcacctgcgcaggaagagaaaaaagcagcggctccggcggctgcgcctgct
gccgcggcggcaaaagacgttcacgttcctgacatcggcggcgacgaagttgaagtcacc
gaaatcctggtgaaagtgggcgacaccgttagcgctgagcagtccctgatcactgtagaa
ggcgacaaagcctctatggaagttccggcgccgttcgccggcaccgtgaaagagatcaaa
gtgaacaccggcgacaaagtgtccaccggctctctgatcatggtcttcgaagtggcgggc
gctgcgcctgctgctgcgcctgtacaggccgccgctccggctgcggcggcaccggcagcg
tctggtcctaaagaagttcacgtaccggacatcggcggcgacgaagttgaagtgaccgaa
gtgatggttaaagtgggcgataaaattgccgctgaacagtcgctgatcaccgttgaaggc
gataaggcttccatggaagtccctgcgccgttcgcgggtaccgttaaagagatcaaaatc
agcaccggcgacaaagtgtctaccggctctctgatcatggtcttcgaagtagaaggcgct
gcgcctgccgctgctgctccggcacctgctgctgctccggctcaggcggcgaaatccgct
gctgcgcctacggctaaagcggaaggcaaatccgagttcgctgaaaacgacgcttatatt
cacgcgactccgctgattcgtcgcctggcgcgcgaattcggcgttaacctggcgaaagtg
aaaggcaccggccgtaaaggtcgtatcctgcgcgaagacgttcaggcttacgtgaaagac
gcggtgaaacgcgctgaagctgcacctgctgctgctaccggcggcggtatcccgggcatg
ctgccatggccgaaagtggacttcagcaagtttggtgaaatcgaagaagtggagctgggc
cgcatccagaaaatctctggcgccaacctgagccgtaactgggtgatgatcccgcacgtt
acgcacttcgataagaccgatatcaccgatctggaagcgttccgtaaacagcagaacgcc
gaagctgagaagcgcaaactggacgtgaaattcaccccagtggtcttcatcatgaaagcc
gttgccgccgctctggaacagatgccgcgctttaacagctctctgtccgaagacggccag
cgtctgaccctgaaaaagtacatcaacattggtgttgcggtagatacgccgaatggtctg
gtggttccggtcttcaaagacgtgaacaagaagagcattaccgagctgtctcgcgaactg
accgttatctccaaaaaagcgcgtgacggtaagctgaccgctggcgaaatgcagggcggc
tgcttcaccatctccagcatcggtggcctgggcaccacccacttcgcgccgatcgtgaac
gcgccggaagtggctatcctcggtgtctccaagtccgcgatggagccggtgtggaatggt
aaagagttcatgccgcgtctgatgatgccaatctctctgtccttcgaccaccgcgtgatt
gacggtgctgatggtgcgcgcttcatcaccatcatcaacaacatgctgagcgacattcgc
cgcctggtgatgtaa

DBGET integrated database retrieval system