KEGG   Enterobacter lignolyticus: Entcl_3714Help
Entry
Entcl_3714        CDS       T01342                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
esc  Enterobacter lignolyticus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Entcl_3714
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Entcl_3714
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Entcl_3714
Enzymes [BR:esc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Entcl_3714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3991691..3992977)
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFARAVTQGLGKRQGLFFPHDLPEFSLTEVDEMLQQDFVSRSAKILS
AFIGDEIPAAELEARVRAAFAFPAPVSQVQADVGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKQTLGLNSANSINISRLLAQICYYFEAVAQLPREARNQ
LVISVPSGNFGDLTAGLLARSLGLPVKRFIAATNVNDTVPRFLQEGEWKPKATQATLSNA
MDVSQPNNWPRVEELFRRKVWRLKDLGYASVDDETTKATMRELQALGYTSEPHAAVAYRA
LRDALQPGEYGLFLGTAHPAKFKESVEAILGQTLSLPKELAERADLPLLSHNLLADFAAL
RQFMMRNA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataacttaaaagatcacaacgagcaggtcagcttcgcgcgggccgtcacc
cagggcttaggcaagcgtcaggggctgtttttcccgcacgatctgccggagttcagcctg
accgaagtcgacgaaatgctgcagcaggatttcgtcagccgcagcgcgaagatcctttcc
gcatttatcggcgatgagatcccggcggccgagctggaggcccgcgtccgggcggcgttt
gctttcccggcgccggtaagccaggtgcaggccgatgtcggctgccttgagctgttccac
gggccgacgctggcgtttaaagacttcggcggccgcttcatggcgcagatgctgacccac
atcagcggggacaagccggtcacaatcctgacggcgacgtcaggggataccggggcggcc
gtcgcgcatgctttctacggcctgaagaatgtccgcgtggttatcctctatccgcgcggc
aaaatcagtccgctgcaggagaagctgttctgtaccctgggcggcaatattgagaccgtc
gcgatcgacggcgatttcgacgcctgccaggcgctggtgaagcaggctttcgacgatgaa
gagctgaagcagacgctggggctgaactccgcgaactcgatcaatatcagccgcctgctg
gcgcagatctgctactactttgaagccgtggcgcagctgccgcgagaggcgcgcaatcag
ctggtgatctcggtgcccagcggcaacttcggcgatctgacggcggggctgcttgcccgg
tcgctggggctgccggtgaagcgttttatcgccgcgacgaacgtcaacgacaccgtaccg
cgcttcctgcaggaaggcgagtggaagccgaaagccacgcaggccacgctgtcaaacgcg
atggatgtcagccagccgaacaactggccgcgggtggaggagctgttccgccgtaaagtg
tggcgcctgaaggacctcggctacgcgtcggtggacgatgagaccaccaaagcgaccatg
cgcgagctgcaggcgctgggctacacctctgaaccgcatgcggcggtggcgtatcgcgcg
ctgcgcgacgcgctgcagcccggcgagtacgggctgttcctcggcaccgcgcatccggcg
aagttcaaagagagcgtggaggctattcttggccagacgctgtcgctgccaaaagagctg
gccgaacgcgccgatctgccgctgctgtcgcacaacctgctggctgatttcgccgcgctg
cgtcagtttatgatgcgcaacgcgtaa

DBGET integrated database retrieval system