KEGG   Enterobacter cloacae SCF1: Entcl_3760Help
Entry
Entcl_3760        CDS       T01342                                 

Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
esc  Enterobacter cloacae SCF1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:esc00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:esc00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:esc03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:esc03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:esc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4046856..4047269)
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPTVLQGEIAISLPEHVRLVIVADALPPLTDPMMGDVLRA
FAVTPDQVLQLTPERVAMLPQGSRCNSWRLGEGDAIALEGAHVTSPAFNELQASAPARAA
LWQQICAHEHDFFPKPD
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagctacagcaactgggcatcacccagtggtctttgcgt
cgcccaacggtgctgcagggcgaaatcgctatctcactgcctgaacatgttcgtctggtg
atcgtcgccgatgcgctgccgccgctgacagacccgatgatgggcgatgtcctgcgggcg
ttcgcggtgacgccagaccaggttctgcaactgacgcctgagcgtgtggccatgctgccg
cagggcagccgttgcaacagctggcggctcggcgaaggcgacgcgatagcgctggaaggc
gctcacgttaccagcccggcttttaatgaactgcaggccagcgccccggctcgcgccgcg
ctctggcaacaaatttgcgcccatgaacacgatttcttccctaagcctgactga

DBGET integrated database retrieval system