KEGG   Enterobacter lignolyticus: Entcl_3891Help
Entry
Entcl_3891        CDS       T01342                                 

Definition
DNA-directed DNA polymerase (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
esc  Enterobacter lignolyticus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Entcl_3891
   00240 Pyrimidine metabolism
    Entcl_3891
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Entcl_3891
   03430 Mismatch repair
    Entcl_3891
   03440 Homologous recombination
    Entcl_3891
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Entcl_3891
DNA replication proteins [BR:esc03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Entcl_3891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4185084..4185527
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDNTVDGLSTVEQLVCEIAAERWRAGKRVLVACEDEQQAIRLDEALWTRP
PESFVPHNLAGEGPRGGAPVELAWPQKRNSSPRDVLISLRTGFADFATAFTEVIDFVPHE
DSLKQLARERYKAYRLAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgcaacgttctaccttctggacaatgacaacaccgttgacggcctcagtacc
gttgaacagctggtgtgtgaaattgccgcagaacgttggcgcgcaggcaaacgcgttctg
gttgcctgtgaagatgagcagcaggcgattcggctggatgaagcgctgtggacgcggccg
ccggaaagctttgtgccgcataatctggcgggagaaggcccgcggggcggcgccccggtc
gagctggcctggccgcaaaagcgcaacagcagcccgcgcgatgtgctgattagcctgcgt
acaggctttgcagattttgccaccgctttcacagaagtgatagacttcgtacctcacgaa
gattctttgaaacaactggcgcgcgaacgctacaaagcgtatcgcctggctggttttaac
ctgaacacggcaacctggaaataa

DBGET integrated database retrieval system