KEGG   Enterobacter lignolyticus: Entcl_3905Help
Entry
Entcl_3905        CDS       T01342                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
esc  Enterobacter lignolyticus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Entcl_3905
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Entcl_3905
Enzymes [BR:esc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Entcl_3905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4199246..4200181
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSREDLELVLATAAKLKAHPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GGIPVLNAGDGANQHPTQTLLDLFTIQETQGRLENLSVAMVGDLKYGRTVHSLTQALAKF
NGNRFYFIAPDALAMPQYILDMLDEKGIAWSLHGAIEEVMEEVDILYMTRVQKERLDPSE
YANVKAQFVLRAADLEGARANMKVLHPLPRIDEITPDVDKTPHAWYFQQAGNGIFARQAL
LALVLNSDMAL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaatccgctttatcaaaaacatatcatttccataaacgatctcagccgcgaagac
cttgaactggtgctggcgacagcggctaagctgaaagcccacccgcagccggagctgctc
aagcataaggtcattgccagctgcttctttgaagcctctacccgcacccgcctgtcgttt
gaaacctccatgcaccgcctcggcgcgagcgtagtgggcttctccgacagtgccaacacc
tcgctgggcaaaaaaggcgaaacgctggcggacaccatttcggtcatcagcacctatgtc
gatgccatcgtaatgcgccacccgcaggaaggggcggcacgcctggcgaccgagttctcc
ggcggtattccggttctgaacgccggggacggcgcgaaccagcaccccacgcagacgctg
ctggatctgttcaccattcaggaaacccagggacgtctggaaaacctgagcgtggcgatg
gtcggcgacctgaagtatggccgcaccgtccactccctgacccaggcgctggccaagttc
aacggcaaccgcttctactttatcgccccggacgcgctggcgatgccgcagtacatcctc
gatatgctggatgaaaaaggcattgcgtggagcctgcacggcgccattgaggaggtgatg
gaagaggtggacattctgtacatgacccgcgtacagaaagagcgtctcgacccgtcggag
tacgccaacgtcaaagcccagttcgtcctgcgcgcggctgacctcgagggcgcccgcgcc
aacatgaaggtgctgcatccgctgccgcgcattgatgaaattacgcccgatgtcgataaa
acgccgcacgcctggtacttccagcaggccggtaacggcatcttcgcccgccaggcgtta
ctggcactggttttgaacagcgacatggcactgtaa

DBGET integrated database retrieval system