KEGG   Enterobacter lignolyticus: Entcl_3908Help
Entry
Entcl_3908        CDS       T01342                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
esc  Enterobacter lignolyticus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Entcl_3908
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Entcl_3908
Enzymes [BR:esc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Entcl_3908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4201293..4203683)
Genome map
AA seq 796 aa AA seqDB search
MLKTVRYSLLTTGLLLSGYTLASPAGDLPLMPWPAQVERPAQGALAIDNRLTIRVTGDDL
GPAVGRWRERIARQTGWVLMPQAAGVTSPTIDIAIARSVAAIPRPDSDESYRLTVSASGV
KLTANTRFGALRGMETLLQLIQNGPENTAIPYVSITDAPRFPWRGLLLDSARHFMPLEDI
KRQLDGMAAAKLNVFHWHLTDDQGWRFASNRYPKLQQLASDGQFYTQAQMKEVVRYAAER
GIRVVPEIDMPGHASAIAVAYPELMSAPGPYEMERHWGVLKPVLDPTKEATYAFADAIVG
ELAAIFPDAYLHIGGDEVDDTQWKNNPAIQRFMQQNALADSHALQAYFNRRLERILEKYH
RQMVGWDEIYHPDLPKSILIQSWQGQDALGEVAKNGYKGILSTGFYLDQPQYAAYHYRND
IVPQGLNGVDTLSDADSAQSWSFSMPRLKGSPVEGSFTLVKGEDGWRGFIDFKGKSRRAV
QNIEWLSDDQMTFSVDTWMGETRPLLTVSNDSISGYFLIGNTRYPASGKRLEAVPAGTPP
VVPDAEQQKNLLGGEAALWAENIVAPVLDIRLWPRAFAVAERLWSAQDVQDTDNMYQRLQ
AVDGWSTVSVGLQQHTQQLQQFARLASGSSTLALQILAQAVEPAHYYTRQHLKFQAGNYH
QFEPLNRFADALPAESMTVHSLNRWAERLVSDAEDTESADALRHVFTRWQSNTPDALALA
GANYQLAAIKPVVAQVDKLAALGLRLTDLVARQGTLDDKEYASIQAQLDEAAKTQDEVVI
AAVYPLETLLRATRIE
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaacagtgcgttacagtttactgacgaccggacttttgctcagtggctacacc
ctcgcgtctcccgccggcgatctgccgctgatgccctggcccgcgcaggtggaacgaccg
gcgcagggcgcgctggcgattgacaaccggctgaccattcgcgtgacgggcgatgatcta
ggcccggccgtcggccgctggcgcgagcgcatcgcccgccagacgggctgggtgctgatg
ccgcaggccgcaggggtaacatcgcccaccattgacatcgccattgcccgcagcgtggcg
gccatcccccgtcccgacagcgatgaaagctatcggctgacggtgagcgccagcggcgtg
aagctcaccgccaatacccgcttcggcgccctgcgcggcatggagacgctgctgcagctt
atccagaacgggccggaaaataccgccatcccttacgtcagcattaccgacgcgccgcgc
ttcccgtggcgcgggctgctgctcgactcggcgcgccactttatgccgctggaggacatt
aagcgccagcttgacggcatggcggcggccaagcttaacgtcttccactggcatttaacc
gacgatcagggctggcgctttgcctcaaaccgctatcccaaactgcagcagctggccagc
gacggtcagttttacacccaggcgcagatgaaagaggtggtgcgctacgcggcggagcgg
ggcattcgcgtggtgccggaaatcgacatgccggggcatgcgtcggccattgcggtggcg
tatccggagctgatgagcgcgcccgggccgtatgagatggagcgtcactggggcgtgctc
aagccggtgctcgacccgacaaaagaggcgacctatgcctttgctgacgccattgtcggc
gaactggcggcgatttttcccgatgcttatctgcatatcggcggcgatgaggtagacgac
acccagtggaagaataacccggcaatccagcgctttatgcagcagaacgcgctggcggac
agccacgccctgcaggcgtacttcaaccgccggctggagcggattctggaaaaatatcac
cgccagatggtcggctgggatgagatttaccatcccgacctgccgaagagcattttgatc
cagtcctggcaggggcaggacgcgctcggcgaagtggcgaaaaacggctacaaaggcatc
ctgtccaccggtttctacctcgaccagccgcagtacgccgcctatcactaccgcaatgac
atcgtgccgcaggggctgaacggcgtcgacaccctcagcgatgccgacagcgcgcagagc
tggtcgtttagtatgccgcggctgaaaggcagcccggttgaaggcagcttcaccttggta
aagggcgaagacggctggcgcggattcatcgattttaaaggcaagtcccgccgcgcggtg
cagaacattgagtggctgagcgacgaccagatgaccttcagcgtcgacacctggatgggg
gaaacccgcccgctgctgacggtcagcaatgacagcatcagcggctacttcctgatcggc
aacacccgctacccggcgagcggcaagcgtcttgaggcggtgcccgcggggacgccgccg
gtggtgccggacgccgaacagcagaaaaacctgctcggcggcgaagcggcgctgtgggcg
gaaaatatcgttgctccggtgctggacatccggctgtggccgcgcgcctttgccgtggcg
gagcggctgtggtcggcgcaggatgtgcaagataccgacaatatgtaccagcggctgcag
gcggttgacggctggtcgacggtatcggtggggctgcagcagcacacccagcagctgcag
cagttcgcccggcttgccagcggcagcagcacgctggcgctgcaaatcctcgctcaggcc
gtggagcctgcgcactattacacccgtcagcatctcaagttccaggcggggaactatcac
cagtttgagccgctgaaccgctttgccgacgcgctgccggcggagagcatgaccgtacac
agtcttaaccgctgggcggagcgcctggtcagcgacgccgaagatacggaaagcgcggac
gcgctgcgccatgtgttcacccgctggcagagcaatacgccggacgctctggcattggcc
ggggcgaactatcagctggcggcgataaagccggtggtggcgcaggtggataagctggcg
gcgctggggctgcgcttaaccgatctggtggcgcgtcaggggacgctcgatgataaagag
tatgcgtcgattcaggcgcagctcgacgaggcggccaaaacccaggatgaggtggtgatt
gcggcggtgtatccgctggaaacgctgctgcgggcgacgcgaattgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system