KEGG   Enterobacter cloacae SCF1: Entcl_3950Help
Entry
Entcl_3950        CDS       T01342                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
esc  Enterobacter cloacae SCF1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:esc00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4250705..4251445)
Genome map
AA seq 246 aa AA seqDB search
MLEHVCQLARSAGDAIMQVYDGATPMDVASKADDSPVTAADIAAHKVIVAGLKALTPDIP
VLSEEDPPGWEVRQHWQQYWLVDPLDGTKEFIKRNGEFTVNIALIDKGKPVLGVVYAPVM
KMMYSAHEGKAWKEECGIRKQIRVRDARPPLVVISRSHADNELKEYLQQLGDHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTNVWDTAAGHAVAVAAGAHVHDWQGRTLDYTPRESFLNPG
FRVSIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgctagaacatgtatgtcagcttgcacggagcgcgggcgatgccattatgcaggtctac
gatggagcaacgccaatggatgtcgccagcaaggctgacgattctccggtaaccgccgca
gatatcgccgcgcataaggtgattgtggccgggttaaaggcgctgacgccggatattccg
gtgctttccgaagaggatcctcctggctgggaggtgcgtcagcactggcagcagtactgg
ctggtggaccccctggacgggacaaaagagtttatcaagcgcaatggcgaatttaccgtc
aatatcgccctgattgataagggaaaaccggtgctcggcgttgtgtatgcgccggtgatg
aagatgatgtacagcgcccatgagggcaaagcgtggaaagaagagtgcggcatacgtaag
cagattcgggtgcgcgacgcccgcccgccgctggtggtgataagccgctcccacgccgat
aacgagcttaaagagtacctccagcagctgggagaccaccagacgacgtcgataggctca
tcgctgaagttctgcctggtggcggaagggcaggcccagctgtacccgcgttttgggccg
accaacgtctgggacaccgcggcggggcatgccgtggcggtagcggccggggcgcatgtt
cacgactggcagggaagaacccttgactatacgccgcgtgaatccttcctgaaccccggt
tttcgggtgtcgatttactga

DBGET integrated database retrieval system