KEGG   Enterobacter cloacae SCF1: Entcl_4037Help
Entry
Entcl_4037        CDS       T01342                                 

Definition
glycoside hydrolase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
esc  Enterobacter cloacae SCF1
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:esc00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4344119..4345894
Genome map
AA seq 591 aa AA seqDB search
MGTFTVEKNLLQDGKPVQLISGAIHYFRLVPQYWEHSLNNLKALGANCVETYLPWNIHQP
DPERFCFTGMADVERFIALAQRKGLFVILRPSPYICAEWEFGGLPAWLLRDPSMRVRSSQ
PAFLQAVERYYAELLPRLAPWQYDRGGPVVMMQLENEYGSFGNDKAYLRTLAAMMRRYGV
SVPLFTSDGAWQEALQAGSLCEDNVLATANFGSRSAESLDNLAAFQPERPLMCLEFWNGW
FNRYGDAIIRRDADDVGQEIRTLLTRASINIYMFQGGTNFGFMNGCSVRGDKDLPQVTSY
DYDALLSEWGEPGAKFFAVQQVIRQHSPEAEQFEPVGLPHRAYGAIALSRKVSLFATLPT
LSLPVKSPWPLTMEEVGQNYGYILYRCHKAGPGKVEKCRVVDAGDRVQFYCNGEHLATQY
HEQIGEQIPFALREADNVLDLLIENMGRVNYGPRLLAPTQRKGLRGGLVIDLHLETDWDI
FPLPLDNIDDVDFSAGWQPQQPAFYEYCFAIDSPADTFLDTRSLGKGVAFINGFNLGRYW
YRGPLGYLYIPAPLLKQGENRLIIFETEGVEVGALALLNKPVYIEVTESTT
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgggtacctttacggtcgaaaaaaacctgctgcaggacggcaaacccgtgcagctgatt
tccggcgcaatccactatttccgcctcgtaccgcagtactgggagcacagcctcaacaac
ctcaaagcgctgggcgccaactgtgtggaaacctatctgccgtggaatatccaccagccg
gatccggagcgcttttgctttaccggcatggcggacgtcgagcgcttcatcgcgctggca
cagcgcaaaggactgttcgttattttgcgcccctcgccttatatctgcgcggagtgggag
tttggcggccttccggcctggctgctgcgcgatccgtcgatgagggtacgcagcagccag
cccgcgtttttacaggcggtcgagcgctactacgctgaactgctcccccgcctcgcaccc
tggcagtacgatcgcggtgggccagtggtgatgatgcagttggaaaacgaatatggctcg
tttggcaacgacaaagcctaccttcgcacgctggcggcaatgatgcgccgatatggcgtc
agcgttccgctattcacctccgacggtgcctggcaagaggcgctgcaggcagggtccctg
tgcgaagacaacgttctggcgacagcgaatttcggctcccgctccgccgaaagcctcgat
aacctcgcagccttccagccggagcgtccgctgatgtgcctggagttctggaacggctgg
tttaaccgctatggcgacgcgattattcgccgtgacgccgacgacgtcggccaggaaata
cgcactcttctgacgcgcgccagcatcaatatctacatgtttcagggtggtaccaacttt
ggttttatgaacggctgctccgtacgcggtgataaagacctgccgcaggtcacctcctat
gattacgacgcgctgctgagcgaatggggcgagccgggggcgaaattcttcgccgtacag
caggttatccgtcagcactcgccggaggcggaacagttcgagccggttgggctaccacac
cgcgcctatggcgcgatcgcgctcagccggaaagtcagcctgtttgcaacgctcccaacc
ctgagccttccggtaaaaagcccctggccgctgacgatggaagaggtcggacaaaactac
ggttatattctctaccgctgtcataaggcaggccccgggaaggtcgagaaatgccgggtg
gtcgatgcgggcgatcgggtgcagttttactgcaacggcgaacatctggcgacccagtat
cacgagcagataggcgagcagattccgtttgcgttacgcgaggctgacaacgtgctggat
ctgctcatcgaaaatatgggtcgggtcaactacggtccgcggttgctggcccccacccag
cgcaaagggttgcgcggagggctggtcattgacctgcatctggagacggattgggacatt
tttccgctgccgctggataatatcgacgacgtcgatttttccgcgggctggcagccgcag
caaccggcattttatgaatattgctttgctatcgacagcccggctgataccttccttgat
acccgctcgctcggtaaaggcgtggcgtttatcaacgggttcaatcttggtcgctactgg
tatcgcgggccgctgggttatctgtatatcccggcgccgctgctcaagcagggagagaat
cgactgatcatcttcgaaaccgaaggggtggaggtgggtgcgttagccctgctgaataaa
ccggtttacattgaggttactgagagcacaacgtga

DBGET integrated database retrieval system