KEGG   Enterobacter lignolyticus SCF1: Entcl_4192Help
Entry
Entcl_4192        CDS       T01342                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00071  Fatty acid degradation
esc00280  Valine, leucine and isoleucine degradation
esc00281  Geraniol degradation
esc00310  Lysine degradation
esc00362  Benzoate degradation
esc00380  Tryptophan metabolism
esc00410  beta-Alanine metabolism
esc00640  Propanoate metabolism
esc00650  Butanoate metabolism
esc00903  Limonene and pinene degradation
esc00930  Caprolactam degradation
esc01040  Biosynthesis of unsaturated fatty acids
esc01100  Metabolic pathways
esc01110  Biosynthesis of secondary metabolites
esc01120  Microbial metabolism in diverse environments
esc01130  Biosynthesis of antibiotics
esc01200  Carbon metabolism
esc01212  Fatty acid metabolism
Module
esc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Entcl_4192
   00650 Butanoate metabolism
    Entcl_4192
  Lipid metabolism
   00071 Fatty acid degradation
    Entcl_4192
   01040 Biosynthesis of unsaturated fatty acids
    Entcl_4192
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Entcl_4192
   00310 Lysine degradation
    Entcl_4192
   00380 Tryptophan metabolism
    Entcl_4192
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Entcl_4192
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Entcl_4192
   00281 Geraniol degradation
    Entcl_4192
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Entcl_4192
   00930 Caprolactam degradation
    Entcl_4192
Enzymes [BR:esc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Entcl_4192
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Entcl_4192
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Entcl_4192
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Entcl_4192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ADO50425
UniProt: E3G376
Position
4531831..4534020
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGQALDVLEKQKDLKGLLLRSE
KAAFIVGADITEFLSLFQVPQEQLSQWLHFANSVFSRLEDLPVPTLSAVNGYALGGGCEC
VLATDYRLATADLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIVAGKDVGAEEALK
IGLIDGIVKPEKLRDGAVAMLRQAIDGALDWKAKRQPKLEPLRLSKIEAAMSFTIAKGMV
AQTAGKHYPAPMTAVKTIEAAARFGRDEALALENQSFVPLAHSSEARALVGIFLNDQFVK
SQAKKLTKNVETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFERVDVVVEAVVENPKVKKAVLAETEDKVRP
DAVLASNTSTIPISELAHALKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDDTIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDASRYGQKNGLGFWRYKEDSKGKP
KKEEDPAVDGLLAEVSKPKRDFTDEEIVARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQFQHLGALYEVPAGLRDKARHNEAYYPPVEPA
RPVGELKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgataccctgtacctcgactggctggaagatggcattgccgaactg
gtgttcgatgcccccggctcggtcaataagctcgatacggcaaccgtagccagcctcggc
caggcgctggacgtcctcgaaaaacaaaaagatctcaagggcctgctgctgcgctctgaa
aaagccgcgtttatcgtcggcgccgatatcaccgaattcttatccctgttccaggttccg
caggaacagttaagccagtggctgcatttcgcaaatagcgtctttagccgcctggaagac
ctgccggtccctaccctctccgccgtcaacggctacgcgcttggcggcggctgcgaatgc
gtgctggcgaccgactatcgcctggcaaccgccgatctgcgcatcgggctgccggaaacc
aaactgggcattatgcccggctttggcggctcggttcgcctgccgcgcatgctcggcgcc
gacagcgcgctggagatcatcgtcgcaggtaaagacgtcggcgcggaagaagcgctgaaa
attggcctgatcgacggcattgtaaaacccgagaagctgcgcgacggcgcggtggcgatg
ctgcgtcaggctatcgacggcgcgcttgactggaaagccaagcgccagccaaagctggag
ccgctgcgcttaagcaaaattgaagccgccatgagcttcaccatcgccaaaggcatggtg
gcacagacggccggcaaacattacccggcgccgatgacggcggtaaaaaccattgaagcg
gcagcccgttttggccgcgacgaggccctggcgcttgagaaccagagttttgttccgctg
gcgcactccagcgaagcccgcgcgctggtcggaatcttcctgaacgatcagtttgtcaaa
agccaggcgaaaaagctgaccaaaaacgttgagacgccaaaacaggccgccgtactgggc
gcaggcatcatgggcggtggtatcgcttatcagtcggcctggaagggcgtgccggtcatt
atgaaggacatcaacgataagtctctgacgctcggcatgaccgaagcggcaaagttgctt
aacaaacagctggagcgcggaaaaatcgacggactgaagctggcgggggtcatttcgacc
attcacccaacgctggactatgccggttttgagcgcgtcgatgtggtcgtagaggcggtt
gttgaaaacccgaaagtgaaaaaagcggtgctggcggaaaccgaagacaaggttcgcccg
gacgccgtgctggcctcgaacacctcgacgatccccattagcgaactggcgcacgccctg
aagcgcccggaaaacttctgcggcatgcacttctttaacccggtacaccgcatgccgctg
gttgaggtgattcgcggcgagaagacctctgacgataccatcgccaaagtcgtggcatgg
gcgagcaagatgggcaaaacgccgatcgtggtgaacgactgccccggattctttgtcaac
cgcgtgctgtttccgtactttgccggcttcagccagctgctgcgcgacggcgcggatttc
cgcaaagtcgataaagtgatggaaaaacagttcggctggccgatgggcccggcgtatctg
ctggacgtcgtcggtatcgacaccgcgcaccacgctcaggcggtgatggcggcggggttc
ccgcagcggatgcagaaagattaccgcgacgctatcgatgcgctgtttgatgccagccgc
tatggccagaaaaacggtctcggcttctggcgttataaagaagacagcaaaggcaagccg
aaaaaagaggaggacccggccgtggacggcctgctcgccgaggtcagcaaaccaaaacgc
gacttcaccgacgaagagatcgtcgcccgcatgatgattccgatggtcaacgaagtggtg
cgctgtctggaagaaggcattatcgcaagcccggcggaagccgatatggcgctggtgtat
ggtttaggtttccctccgttccacggtggcgccttccgctggctggataccctgggcagc
gcgaagtatctcgatatggcgcagcagttccagcacctcggcgcactgtatgaggtaccg
gcaggcctgcgcgacaaagcgcgccataacgaagcatattatcccccggttgagcccgcc
cgtccggtcggcgagctgaaaacggcttaa

DBGET integrated database retrieval system