KEGG   Enterobacter lignolyticus: Entcl_4231Help
Entry
Entcl_4231        CDS       T01342                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
esc  Enterobacter lignolyticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Entcl_4231
Enzymes [BR:esc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Entcl_4231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4572999..4573739
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSEQGEELVRRLQAMGREAWSFPLIEFTPGRDLPGLAQAMSALGAGDLLFALS
QHAVDFAHGQLQQSGLRWPSPPGYFAIGRTTALALHTVSGIDVRYPLDREISEVLLQLPE
LQNITGKKALILRGNGGRELLGDTLSARGADVTFCECYQRTPRHYDGAEEAMRWQSRGVT
TLVTTSGEMLQQLWSLIPPWYRERWLLECKMVVVSERLARLARELGWKDIQVADSADNDA
LLRAIP
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtattctggtcactcgcccctctgagcaaggagaagagctggtccgccgcctgcag
gcgatggggcgagaggcctggagctttccgctcattgaatttacccccggccgcgatctt
cccgggctcgcgcaggcgatgtccgcgctgggcgcaggcgatttattattcgcgctgtcg
cagcacgccgtcgacttcgcccacgggcagctgcagcagtccggcctgcgctggccgtcg
ccgcccggctacttcgccatcggacgcaccaccgcgctggcgctgcacaccgtcagcggc
atcgacgttcgctatcctttggatcgggaaatcagcgaagtattgctacaattacctgaa
ttacaaaatattacgggcaaaaaggcgctgattctgcgcggcaacggcggacgggagctg
ctgggcgatacgctgagcgcccgcggcgccgatgtgacgttttgtgaatgttatcaacga
actccccgacactatgacggcgcagaagaagccatgcgctggcagtcgcgcggggtgacg
acgctggtcacgaccagcggggaaatgttacaacagctctggtcgctaatccccccgtgg
tatcgcgaacgctggctgctggagtgcaaaatggtggtcgtcagcgaacggctcgcccgt
ctggcccgcgagttgggctggaaggatattcaggtggctgatagcgccgacaacgacgcg
ctgctgcgtgctataccctaa

DBGET integrated database retrieval system