KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_0245Help
Entry
ECSF_0245         CDS       T02077                                 

Definition
gamma-glutamate kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ese00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECSF_0245
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ECSF_0245
Enzymes [BR:ese01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ECSF_0245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
274339..275442
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPR
SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPG
VIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVDEGATAAILERGSSLLPKGI
KSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaactcggcaccagtgtgctaacaggcggatcg
cgccgcctgaaccgtgcccatatcgttgaacttgttcgccagtgcgcgcagttacatgcc
gccgggcatcggattgttattgtgacgtcgggtgcgattgccgccggacgtgagcacctg
gggtacccggaattgccagcgactatcgcttcaaaacagctgctggcggcggtagggcag
agtcgactgattcaactgtgggaacagctgttttcaatttacggcattcatgtcgggcag
atgttgctgacccgtgctgatatggaagatcgtgaacgcttcctgaacgcccgcgatacc
ctgcgtgcgttgctcgataacaatatcgttccggtaattaatgagaacgatgctgtcgct
acggcagagattaaggtcggtgataacgataacctttctgcgctggcggcgattctggcg
ggtgccgataaactgttgctgctgaccgatcaaaaaggtttgtataccgctgacccgcgc
agcaatccgcaggcagaactgattaaagatgtgtacggcattgatgacgcactgcgcgcg
attgccggtgatagcgtttcaggcctcggaactggcggtatgagcaccaaattgcaggcc
gctgacgtggcttgccgtgcgggtatcgacaccattattgccgcgggcagcaagccgggc
gttattggtgatgtgatggaaggcatttccgtcggtacgctgttccatgcccaggcgact
ccgcttgaaaaccgtaaacgctggattttcggtgcgccgcctgcgggtgaaatcacggta
gatgaaggggcaactgccgccattctggaacgcggcagctccctgttgccgaaaggcatt
aaaagcgtgactggcaatttctcgcgtggtgaagtcatccgtatttgcaacctcgaaggt
cgcgatatcgcccacggcgtcagtcgttacaacagcgatgcattacgccgtattgccgga
caccactcgcaagaaattgatgcaatactgggatatgaatacggcccggttgccgttcac
cgtgatgacatgattacccgttaa

DBGET integrated database retrieval system