KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_0448Help
Entry
ECSF_0448         CDS       T02077                                 

Definition
putative glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ese00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECSF_0448
   00330 Arginine and proline metabolism
    ECSF_0448
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ECSF_0448
Enzymes [BR:ese01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ECSF_0448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
501359..502291
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTSDGNVYSAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKVGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENTEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLINTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEEGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcaggcttacacccaatttcactca
cttaacggcggacaaaatgccgattacattccctttctggcgaatgtccctggtcaactg
gcggcagtggctatcgtgaccagcgatggcaacgtctatagtgcgggtgacagtgattac
cgctttgcgctggaatccatctcgaaagtctgtacgttagcccttgcgttagaagatgtc
ggcccgcaggcggtacaggacaaagttggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctttcgccactggtaaatgctggcgct
attgccaccaccagcctgattaacgctgaaaatactgaacaacgctggcagcgaatttta
catatccaacaacaactggctggtgagcaggtagcgctctctgatgaagtcaaccagtcg
gaacaaacaaccaacttccataaccgggccattgcctggctgctgtactcagccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtacacccgtcagtgctccacgctcatc
aatactattgaactggcaacgcttggcgcgacgctggcggcgggtggtgtgaatccgctg
acgcataaacgcgttcttcaggccgacaatgtgccgtacattctggccgaaatgatgatg
gaagggctgtatggtcgctccggtgactgggcgtatcgcgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgttcctggcgtgatgggaattgccgcgttttca
ccaccactggacgaagaaggcaacagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system