KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_1219Help
Entry
ECSF_1219         CDS       T02077                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ese00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ECSF_1219
Enzymes [BR:ese01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ECSF_1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1304894..1305511
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNSSLFDEIRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDF
RGELFIGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQAGRPYNEGEQVVIGGNERYVS
VCRKHYKEALEVGSLTAIQERHRHD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctatatttctactattccgcaatgaatgcgggtaagtctacagcattgttg
caatcttcatacaattaccaggaacgcggcatgcgcactgtcgtatatacggcagaaatt
gatgatcgctttggtgccgggaaagtcagttcgcgtataggtttgtcatcacctgcaaaa
ttatttaaccaaaattcatcattatttgatgagattcgtgcggaacatgaacagcaggca
attcattgcgtactggttgatgaatgccagtttttaaccagacaacaagtatatgaatta
tcggaggttgtcgatcaactcgatatacccgtactttgttatggtctacgtaccgatttt
cgaggtgaattatttattggcagtcaatacttactggcatggtccgacaaactggttgaa
ttaaaaaccatctgtttttgtggccgtaaagcaagcatggtgctgcgtcttgatcaagca
ggcagaccttataacgaaggtgagcaggtggttattggtggtaatgaacgctacgtttct
gtatgccgtaaacactataaagaggcgttagaagtcggctcattaacggctattcaggaa
aggcatcgccacgattaa

DBGET integrated database retrieval system