KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_1290Help
Entry
ECSF_1290         CDS       T02077                                 

Definition
putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ese00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECSF_1290
Enzymes [BR:ese01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     ECSF_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1378712..1380418
Genome map
AA seq 568 aa AA seqDB search
MGPLPRKGNMQQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVL
ITYADQFHSNDLKPLPTFNQFYPQWLQRIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAG
EWQDIQQLGECSHLMFDFVCNHMSAKSEWFKNYLQQQPGFEDFFITVDPKTDLSAVTRPR
ALPLLTPFQMRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLEKGAEYVRLDAV
GFMWKEPGTNCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGEGDDEAH
MVYQFSLPPLVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPE
NEILALVEVLQQEGALVNWKNNPDGTRSPYEMNVTYMDALSRRECSDEERCARFILAHAI
LLSFPGVPAIYIQSILGSRNDYAGVEKLGYNRAINRKKYSSKEITTELDNKATLRYSVYY
KLSHLITLRRSHKEFHPDNNFTIDAINSFVMRIQRSNADGDCLTGLFNVSENIQHINITD
LHGRDLISEVDILGNEITLHPWQVMWIK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgctaccacggaaaggcaacatgcaacagaaaattacggattacctggacgaa
atctacggtggaacatttaccgcgactcatttacagaaacttgtaacgcgtcttgagagt
gcgaaacgattaattacacagcgacgtaaaaaacactgggatgaaagtgatgtcgtgtta
attacctatgccgatcaatttcacagtaatgatttaaagccactacccacatttaatcag
ttttaccctcaatggctgcaaagaattttttcacatgttcatttattacctttttatcca
tggtcatctgatgatggattttcggtaattgattatcatcaggtcgccagtgaagcgggg
gagtggcaggatattcagcaactcggtgaatgcagccatttaatgtttgattttgtctgc
aaccatatgtcggcaaaaagtgaatggtttaaaaactatttacaacagcagccaggtttt
gaagatttttttattaccgttgatccgaaaaccgatctcagcgccgtcactcgcccgcgt
gcgttaccgttattaacgccattccagatgcgcgatcattcaacgcgtcatttatggacc
acctttagcgacgatcaaattgacctcaattaccgtagccctgaagtgttgctggcgatg
gtggatgtattgctgtgctacctggaaaagggcgcagagtatgtccgtctggatgccgtt
ggctttatgtggaaagagccgggaacaaactgcatccatctggaaaaaacacatctgatt
atcaaactgttacgttcgattattgataacgtcgcgccaggcacagtgatcattaccgag
accaatgttccgcataaagacaacattgcttactttggcgaaggcgatgacgaagcgcat
atggtgtaccagttctcgctgccgccgctggtgctgcatgcggtgcaaaaacagaacgtt
gaggcactttgtgcgtgggcgcaaaacctgacactaccttccagcaacaccacctggttt
aacttccttgcctctcacgatggcatcgggcttaacccactgcgggggttgttacccgaa
aacgaaatattagcgctggtcgaggtgttacagcaggaaggggcattagtaaactggaaa
aataatcccgacggtacgcgtagcccctatgaaatgaatgtcacctatatggatgcgttg
agccgccgtgagtgtagcgacgaagaacggtgtgccaggtttattctcgcccatgcgatt
ttgttaagtttccccggtgtgccagcgatatatattcaaagcattctggggtcgcgtaat
gattacgccggtgtcgaaaaacttggatataatcgcgcgattaaccgtaaaaaatactct
agtaaagagataacgacagaactggacaataaagcgacattaaggtattcggtatattat
aagttgtcgcatttaattacccttcgtcgcagtcataaagagtttcatccggataataat
ttcaccatcgatgcaattaattcatttgtaatgcgaattcaaagaagcaatgcggatggc
gattgcctgacgggattgtttaatgtcagcgaaaatattcagcatataaatattactgac
ctgcacggtcgggatctgattagtgaagttgatatattgggtaatgaaataacactgcat
ccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system