KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_1422Help
Entry
ECSF_1422         CDS       T02077                                 

Definition
(GenBank) putative glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
ese00220  Arginine biosynthesis
ese00250  Alanine, aspartate and glutamate metabolism
ese00471  D-Glutamine and D-glutamate metabolism
ese01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ese00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECSF_1422
   00220 Arginine biosynthesis
    ECSF_1422
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ECSF_1422
Enzymes [BR:ese01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ECSF_1422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase CCD
Motif
Other DBs
NCBI-ProteinID: BAI54962
Position
complement(1536557..1537483)
Genome map
AA seq 308 aa AA seqDB search
MAVAMDNAILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQE
RFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGN
FHHDVTTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQLT
KQLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcgccatggataatgcaattttagaaaacatcttgcggcaagtgcggccgctc
attggtcagggtaaagtcgcggattatattccggcgctggctacggtagacggttcccga
ttggggattgctatctgtaccgttgacggacagctttttcaggccggagacgcgcaagaa
cgtttttccattcagtctatttccaaagtgctgagtctcgttgtcgccatgcgtcattac
tccgaagaggaaatctggcaacgcgtcggcaaagatccgtctggatcaccattcaattct
ttagtgcaactggaaatggagcagggtattccgcgtaatccgtttattaatgccggtgcg
ctggtggtctgcgatatgttgcaagggcgattaagcgcacctcggcaacgtatgctggaa
gtcgtgcgcggcttaagtggtgtgtctgatatttcctacgatacggtggtagcgcgttcc
gaatttgaacattccgcgcgaaatgcggctatcgcctggctgatgaagtcgtttggcaat
ttccatcatgacgtgacaaccgttctgcaaaactactttcattactgcgctctgaaaatg
agctgtgtagagctggcccggacgtttgtctttctggcgaatcaggggaaagctattcat
attgatgaacctgtggtgacgccaatgcaggcgcggcaaattaacgcgctgatggcgacc
agcggtatgtaccagaacgcgggggagtttgcctggcgggtgggactaccggcaaaatct
ggcgttggtggcggtattgtggcgattgttccgcatgaaatggccatcgctgtctggagt
ccggaactggatgatgccggtaactcgcttgcgggcattgccgtccttgaacaattgacg
aaacaattagggcgttcagtttattaa

DBGET integrated database retrieval system