KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_1927Help
Entry
ECSF_1927         CDS       T02077                                 

Definition
dTDP-6-deoxy-D-glucose-3,5 epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ese00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ECSF_1927
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECSF_1927
Enzymes [BR:ese01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ECSF_1927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2058495..2059052)
Genome map
AA seq 185 aa AA seqDB search
MNVIRTEIEDVLILEPRVFGDDRGFFYESFNQSAFEHILGYPVSFVQDNHSRSSKNVLRG
LHFQRGEYAQDKLVRCTHGAVFDVAVDIRPNSVSFGKWVGVLLSADNKQQLWIPKGFAHG
FLVLSDIAEFQYKTTNYYHPESDCGICWNDERIAIDWPQTSGLILSPKDERLFTLDELIR
LKLIA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgattagaactgaaattgaagatgtgctaattctggagccaagagtatttggt
gatgatagaggtttcttttatgagagctttaatcaatcagcatttgaacatattctaggc
tatccggtcagctttgttcaagacaatcactcacgttcatcaaaaaatgtactcagaggc
cttcactttcaacgcggcgagtacgcacaagataaacttgtacgctgcactcatggagca
gtttttgatgttgctgttgatattcgacccaattcggtatcctttggtaaatgggttggt
gttctgctttcagctgataataagcagcagttgtggataccaaaagggtttgctcatggc
tttttggttctgtctgatatcgctgaatttcaatataaaactacaaactattatcatcct
gaaagcgattgtggaatatgttggaatgatgaacgcattgcaattgattggccccaaaca
tcagggttaatcctttcgccaaaagatgaaaggctctttacgttagatgagcttatcaga
ttaaaattaattgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system