KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_2035Help
Entry
ECSF_2035         CDS       T02077                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ese00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECSF_2035
Enzymes [BR:ese01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ECSF_2035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2194736..2195404)
Genome map
AA seq 222 aa AA seqDB search
MPSLSKEAALVHEALVARGLETPLRPPVHEMDNETRKSLIAGHMTEIMQLLNLDLADDSL
METPHRIAKMYVDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRHEFLRAVRHHN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcagtaaagaagcggccctggttcatgaagcgttagttgcgcgaggactg
gaaacaccgctgcgcccgcccgtgcatgaaatggataacgaaacgcgcaaaagccttatt
gctggtcatatgaccgaaatcatgcagctgctgaatctcgacctggctgatgacagtttg
atggaaacgccgcatcgcatcgctaaaatgtatgtcgatgaaattttctccggtctggat
tacgccaatttcccgaaaatcaccctcattgaaaacaaaatgaaggtcgatgaaatggtc
accgtgcgcgatatcaccctgaccagcacctgtgaacaccattttgttaccatagatggc
aaagcgacggtggcttatatcccgaaagattcggtgatcggtctgtcaaaaattaaccgc
atcgtgcagttctttgcccagcgtccgcaggtgcaggaacgtctgacgcagcaaattctc
attgcgctacaaacgctgctgggcaccaataacgtggctgtctctatcgacgcggtgcat
tactgcgtgaaagcgcgtggcatccgcgacgcaaccagtgccacaacaacgacctctctt
ggtggattgttcaaatccagtcagaatacgcgccacgagtttctgcgcgctgtgcgtcat
cacaactga

DBGET integrated database retrieval system