KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_2568Help
Entry
ECSF_2568         CDS       T02077                                 

Definition
(GenBank) sucrose hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
ese00052  Galactose metabolism
ese00500  Starch and sucrose metabolism
ese01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ese00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ECSF_2568
   00500 Starch and sucrose metabolism
    ECSF_2568
Enzymes [BR:ese01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ECSF_2568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: BAI56108
Position
2791436..2792845
Genome map
AA seq 469 aa AA seqDB search
MSMPSQMPAILQAVMKGQSKALADAHYPCWHLAPVTGLMNDPNGFCWSGGRYHLFYQWNP
LACDHKYKCWGHWSSTDLLHWQHEPLALMPDKEYDRNGCYSGSAVNNQGVLTLCYTGNVK
FDDGSRTAWQCLATENNQGGFDKLGPVIPLPDGYTGHVRDPKVWKHNSQWYMVLGAQDKE
KRGKVLLYSSVDLYTWSFHGEIAGNGLNEIDNAGYMWECPDLFALDGEYILLCCPQGMAR
EHERYLNTYPCAWLHGQFDYETGKFTHGAFSELDAGFEFYAPQTMEAPDGRRLLVGWMGV
PDGEEMLQPTRKHHWQHQMTCFRELSFQKGKLFQMPIRELAQLREAEHFWQGKADHAPHV
EIERLEMDIIPSGELYLNFGNALALHLNDDGIQLQRRSLAGQEKLTRYWRGSVTSLKILC
DSSSVEIFINNGEGVMSNRYFPHHPASLILQGESDVTLRYWSLRACMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgccttcacaaatgcccgcgattttacaggcagtgatgaaaggtcagtccaaa
gcactggcagatgcccactatccttgttggcatctcgctccagtcaccggactaatgaac
gatccaaatggcttttgttggtctggaggccgctatcatctgttttatcaatggaatcca
ctggcttgtgatcataagtacaaatgttgggggcactggagttcgacggatttattgcac
tggcagcatgaaccattagcgctaatgcccgataaagagtacgaccgtaatggttgttac
tcaggaagcgcggttaataatcagggcgttctcacactttgctataccggtaatgttaag
tttgatgatggcagcagaacagcatggcaatgtctggccaccgaaaataaccagggcggg
tttgataaactaggccctgtcataccgttacctgatggttacaccggacatgttcgtgat
ccaaaagtctggaagcacaacagccaatggtacatggtgcttggcgcgcaagataaagag
aaacgggggaaagtactgctgtattcctctgtcgatctctatacctggtcttttcatgga
gaaattgctggtaatggtctgaatgaaatagataacgcaggatacatgtgggaatgtcct
gatcttttcgcccttgatggtgaatacattctcctctgctgcccccagggaatggcgcgc
gaacatgagcgctatctgaatacttatccctgcgcctggctacatggacagtttgattac
gagacaggcaagtttacgcatggcgctttctcagagctggatgcgggatttgaattctat
gcaccacagacgatggaagccccggacgggcgacgattgctggtcggctggatgggggtt
cctgatggcgaagagatgttgcaaccaaccagaaagcatcattggcagcatcaaatgacc
tgttttcgcgaactctcattccagaagggaaaattgtttcagatgccaatcagggaactc
gcgcaactgcgtgaagctgaacacttctggcaaggaaaagcggatcatgcgccgcatgtc
gaaattgaacgcctggaaatggacatcattccgtcgggtgagctgtatctgaattttggc
aatgcgctggcactgcatcttaatgacgatggtattcaactacagaggagaagccttgca
gggcaagagaaactaactcgttactggcgaggaagcgtaacgtcactgaagattctctgt
gacagttccagcgtagagatattcatcaataatggtgaaggtgtaatgagtaatcgttat
tttccccatcatccagcttcgctgatattacagggtgagtctgacgtcacgttacgctac
tggtcgctacgcgcctgcatggtagaatga

DBGET integrated database retrieval system