KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_2593Help
Entry
ECSF_2593         CDS       T02077                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ese00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECSF_2593
Enzymes [BR:ese01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     ECSF_2593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2824213..2825988
Genome map
AA seq 591 aa AA seqDB search
MKKISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALLTEKLRHACGAAVECVISDT
CIAGMAEAAACEEKFSSQNVGLTITVTPCWCYGSETIDMDPTRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSL
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRY
GEDENNKQYQRNAEQSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEAILNSSFDWNGVRKPFVVATENDSLNGVAMLMGHQLTGTAQVFA
DVRTYWSPEAIERVTGHKLDGLAEHGIIHLINSGSAALDGSCKQRDSEGKPTMKPHWEIS
QQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VELPKDVHDILNKRTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADF
ITLASMLRIPVCMHNVEETKVYRPSAWAAHGMDIEGQDYRACQNYGPLYKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagcttaccgaaaattggtatccgcccggttattgacggtcgtcgcatg
ggtgttcgtgagtcgcttgaagaacaaacaatgaatatggcgaaagccacggctgcactg
ctgaccgagaaactgcgccatgcctgcggagctgccgtcgagtgtgtcatttccgatacc
tgtatcgcgggtatggctgaagccgctgcttgcgaagaaaaattcagcagtcagaatgta
ggcctcaccattacggtaaccccttgctggtgctatggcagtgaaaccatcgacatggat
ccaacccgcccgaaagccatttggggctttaacggcactgaacgtcccggcgctgtttac
ctggcagcggctctggcagctcacagccagaaaggcatcccggcattctccatttacggt
catgacgttcaggatgccgatgacacatcgattcctgccgatgttgaagaaaaactgctg
cgctttgcccgcgccggtttagcagtcgccagcatgaaaggtaaaagttatctgtcgctg
ggcggcgtttcgatgggtatcgccggttccatcgttgatcacaacttctttgaatcctgg
ctgggaatgaaagtccaggcggtggatatgaccgaactgcgtcgccgtatcgatcagaag
atttacgacgaagccgaactggaaatggcgctggcctgggctgataaaaacttccgctat
ggcgaagatgaaaataacaaacagtatcaacgcaatgccgagcaaagccgcgcagttctg
cgcgaaagtttactgatggcgatgtgtatccgcgacatgatgcaaggcaatagcaaactg
gccgatattggtcgcgtggaagaatcacttggctacaacgccatcgctgcaggcttccag
gggcaacgtcactggaccgatcaatatcccaatggcgataccgctgaagcgatcctcaac
agttcatttgactggaatggcgtgcgcaaaccgtttgtcgtggcgaccgaaaacgacagt
cttaacggcgtggcaatgttaatgggccaccagctcaccggcaccgctcaggtatttgcc
gatgtccgtacctactggtcaccagaagcaattgagcgtgtaacggggcataaactggac
gggctggcagaacacggcatcatccatttgatcaactccggttctgctgcgctggacggc
tcctgtaaacaacgcgacagcgaaggtaaaccgacgatgaagccgcactgggaaatctct
cagcaagaggctgacgcttgcctcgccgctaccgaatggtgcccggcgatccacgaatac
ttccgtggcggcggttactcttcccgcttccttaccgaaggcggcgtcccgttcaccatg
actcgtgtcaacatcatcaaaggcctgggaccggtactgcaaatcgcggaaggctggagc
gtggaattgccgaaggatgtgcatgacatcctcaacaaacgcaccaactcaacctggcca
accacctggtttgcaccgcgcctcaccggtaaagggccgtttacggatgtgtactcggta
atggcgaactggggcgctaaccacggagttctgaccatcggccacgttggcgcagacttt
atcactcttgcctccatgctgcgtatcccggtatgtatgcacaacgttgaagagaccaaa
gtgtatcgtccttctgcctgggccgcgcacggcatggatattgaaggccaggattaccgc
gcttgccagaactacggcccgttgtacaagcgttaa

DBGET integrated database retrieval system