KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_2688Help
Entry
ECSF_2688         CDS       T02077                                 

Definition
protein disulfide isomerase II
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Brite
Enzymes [BR:ese01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ECSF_2688
Secretion system [BR:ese02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ECSF_2688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2950427..2951137)
Genome map
AA seq 236 aa AA seqDB search
MKKGFMLFTLLAAFSGFVQADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYIT
DDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGY
CHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAP
ASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKDMKEFLDEHQKMTSGK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggttttatgttatttaccttgttggcagcgttttcaggctttgttcaggct
gatgacgcggcaattcaacaaacgttagccaaaatgggcatcaaaagcagcgatattcag
cccgcgcccgtagctggcatgaagacagttctgactaacagcggtgtgttgtacatcacc
gatgatggtaaacatatcattcaggggccaatgtatgacgttagtggcacggctccggtc
aatgtcaccaataagatgctgttaaagcagttgaatgcgcttgaaaaagagatgatcgtt
tataaagcgccgcaggaaaaacacgtcatcaccgtgtttactgatattacctgtggttac
tgccacaaactgcatgagcaaatggcagactataacgcgctggggatcaccgtgcgttat
cttgctttcccgcgccaggggctggacagcgatgcagagaaagaaatgaaagctatctgg
tgtgcgaaagataaaaacaaagcgtttgatgatgtgatggcaggtaaaagcgtcgcacca
gccagctgcgacgtagatattgccgaccattacgcacttggcgtccagcttggcgttagc
ggtactccggcagttgtgctgagcaatggcacacttgttccgggttaccagccgccgaaa
gacatgaaagaattcctcgacgaacaccaaaaaatgaccagcggtaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system