KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_3238Help
Entry
ECSF_3238         CDS       T02077                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ese00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECSF_3238
Enzymes [BR:ese01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ECSF_3238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3502526..3504610)
Genome map
AA seq 694 aa AA seqDB search
MESKRLDNAALAAGISPNYINAHGKPQSISAETKRRLLDAMHQRTATKVAVTPVPNVMVY
TAGKKMSVAVEGSGEFSWLLTTEEGKQYKGHVTGGKAFNLPTKLPEGYHTLTLTQDDQRA
HCRVIVAPKRCYEPQALLNKQKLWGACVQLYTLRSEKNWGIGDFGDLKAMLVDVAKRGGS
FIGLNPIHALYLANPESASPYSPSSRRWLNVIYIDVNAVEDFHLSEEAQAWWQLPTTQQT
LQQARDADWVDYSTVTTLKMTALRMAWKGFAQRDDEQMTAFRQFVAEQGDSLFWQAAFDA
LHAQQVKEDEMRWGWPAWPEMYQNVDSPEVRQFCEEHRDDVDFYLWLQWLAYSQFAACWE
ISQGYEMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDP
HIITARAYEPFIELLRANMQNCGALRIDHVMSMLRLWWIPYGETADQGAYVHYPVDDLLS
ILALESKRHRCMVIGEDLGTVPVEIVGKLRSSGVYSYKVLYFENDHEKTFRAPKAYPEQS
MAVAATHDLPTLRGYWESGDLTLGKTLGLYPDEVVLRGLYQDRELAKQGLLDALHKYGCL
PKRAGHKASLMSMTPTLNRGLQRYIADSNSALLGLQPEDWLDMADPVNIPGTSYQYKNWR
RKLSATLESMFADDGVNKLLKDLDRRRRAAAKKK
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaacgtctggataatgccgcgctggcggcggggattagccccaattacatc
aatgcccacggtaaaccgcagtcgattagcgccgaaaccaaacggcgtttgcttgacgcg
atgcatcaacgtaccgccacgaaagtggcggtaacgccagttccgaatgtcatggtttat
accgcgggtaaaaaaatgtcggtggcggttgaaggtagcggtgaatttagctggctgctg
actaccgaagaaggaaagcagtacaaaggccatgtgacggggggcaaagcgttcaatcta
ccgacgaagctgccggaaggttatcacacgctgacgcttacccaggacgaccagcgcgcg
cattgccgggtgattgtcgccccgaaacgctgttacgaaccgcaggcgttgctgaataaa
caaaagctgtggggtgcctgcgttcagctttatacgctgcgatcggaaaaaaactggggt
attggggattttggcgatctcaaagcgatgctggtggatgtggcaaaacgtggcgggtcg
tttattggtctgaacccgattcatgcgctctatctggcaaatccggaaagtgccagcccg
tacagcccgtcttctcgccgttggctgaatgtgatttatatcgacgttaacgcagttgaa
gatttccatcttagcgaagaggctcaggcctggtggcagttgccgaccacgcaacagacg
ctgcaacaggcgcgggatgccgactgggttgattactccacggttaccaccctaaaaatg
acagcattacgaatggcgtggaaaggtttcgcgcaacgtgatgatgagcagatgaccgcg
tttcgccagtttgttgcagagcagggcgacagcctgttctggcaggcagcctttgatgcg
ctacatgcccagcaagtgaaagaggacgaaatgcgctggggctggccagcatggccagag
atgtatcagaacgtggattcaccagaagtgcgccagttctgcgaagaacatcgtgatgac
gtcgatttttatctctggttgcagtggctggcttacagccagtttgccgcctgctgggag
ataagccagggctatgaaatgccgattggcttgtatcgtgatctggccgttggtgtagca
gaaggtggggcagaaacctggtgcgaccgtgaactgtattgcctgaaagcgtcggttggc
gcgccgccggatatcctcggcccgttggggcagaactggggattgccgccaatggacccg
catatcatcaccgcgcgtgcctatgaaccgtttatcgagctgttgcgtgccaatatgcaa
aactgcggcgcattacgaattgatcacgtgatgtcgatgctgcgtttgtggtggataccg
tatggcgagacggcagatcagggcgcgtatgttcactatccggtggatgatctgctctcg
attctggcactcgaaagtaaacgtcatcgctgtatggtgattggtgaagatctcggtacc
gtaccggtagagattgtcggtaagctgcgcagcagcggtgtgtactcctacaaagtgctc
tatttcgaaaacgaccacgagaagacattccgcgcaccgaaagcgtacccagagcagtcg
atggcggttgcggcgacacacgacctgcctacgctacgcggctactgggagagtggggat
ttaacgctgggcaaaacgctggggctgtatccggatgaagtggtactgcgcggtctgtat
caggatcgcgaactggcgaagcaagggctgctggatgctctgcataaatatggttgcctg
ccaaaacgtgccgggcataaggcatcgttgatgtcgatgacaccgacgctgaatcgtggc
ttacagcgctacatcgccgatagcaacagcgccctgttagggctacagccggaagactgg
ctggatatggcagatccggtaaatattcccggcaccagttaccagtataaaaactggcga
cgtaaactttccgcaacgcttgagtcgatgtttgccgatgatggtgtgaacaaattgctg
aaggatttggacagacggcgcagagcggcagcgaagaagaagtag

DBGET integrated database retrieval system