KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_3865Help
Entry
ECSF_3865         CDS       T02077                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
ese00630  Glyoxylate and dicarboxylate metabolism
ese01100  Metabolic pathways
ese01110  Biosynthesis of secondary metabolites
ese01120  Microbial metabolism in diverse environments
ese01200  Carbon metabolism
Module
ese_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ese00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ECSF_3865
Enzymes [BR:ese01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ECSF_3865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: BAI57405
Structure
PDB: 

Jmol
Position
4209359..4210663
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGE
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPANSVPAV
VERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDADAADL
ITSDCDPYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGIHSMWF
NMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGTS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacacaacaaattgaagaattacagaaagagtggactcaaccgcgttgg
gaaggcattactcgcccgtacagcgcggaagatgtggtgaaattacgcggttcagtcaat
ccggaatgcaccctggcgcaactgggcgcggcgaaaatgtggcgtctgctgcacggcgag
tcgaaaaaaggctacatcaacagcctcggtgcactgactggcggtcaggcgttgcaacag
gcgaaagcgggtattgaagcagtctatctgtcgggatggcaggtagcggcggacgctaac
ctggcggccagcatgtatccggatcagtcgctctatccggcaaactcggtgccagctgtg
gtagagcggatcaacaatactttccgccgtgcggatcagatccaatggtccgcgggcatt
gagccgggcgatccgcgctatgtcgattacttcctgccgatcgtcgccgatgcggaggcc
ggttttggcggtgtactgaatgcctttgaactgatgaaagcgatgattgaagccggtgca
gcggcagttcacttcgaagatcagctggcatcagtgaagaaatgtggtcacatgggcggc
aaagttttggtgccaactcaggaagctattcagaaactggtcgcggcgcgtctggcagct
gatgtgacgggcgttccaaccctgctggttgctcgtaccgatgccgatgcggcggatctg
attacctccgattgcgacccatatgacagcgaatttattactggcgagcgtaccagtgaa
ggcttcttccgtactcatgcgggtattgagcaagcgatcagccgtggcctggcgtatgcg
ccatatgctgacctggtatggtgtgaaacctccacgccggatctggaactggcgcgtcgc
tttgcacaagccatccacgcgaaatatccgggcaaactgctggcttataactgctcgccg
tcgttcaactggcagaaaaacctcgacgacaaaactattgccagcttccagcagcagctg
tcggatatgggctacaagttccagttcatcaccctggcaggtatccacagcatgtggttc
aacatgtttgacctggcaaacgcctatgcccagggtgagggtatgaagcactatgttgag
aaagtgcagcagccggaatttgccgccgcgaaagatggctataccttcgtatctcaccag
caggaagtgggtacaggttatttcgataaagtgacgaccattattcagggcggcacgtct
tcagtcaccgcgctgaccggctccaccgaagaatcgcagttctaa

DBGET integrated database retrieval system