KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_3999Help
Entry
ECSF_3999         CDS       T02077                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ese00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ese00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ese00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4359788..4361143
Genome map
AA seq 451 aa AA seqDB search
MMSAPKITFIGAGSTIFVKNILGDVFHREALKTAHIALMDIDPTRLEESHIVVRKLMDSA
GASGKITCHTQQKEALQDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGI
MRALRTIPHLWQICEDMTEVCPDATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTA
EELARDLNIDPATLRYRCAGINHMAFYLELERKTADGSYVNLYPELLAAYEAGQAPKPNI
HGNTRCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLIERYKVPLDEYPKRCV
EQLANWHKELEEYKNASRIDIKPSREYASTIMNAIWTGEPSVIYGNVRNDGLIDNLPQGC
CVEVACLVDANGIQPTKAGTLPSHLAALMQTNINVQTLLTEAILTENRDRVYHAAMMDPH
TAAVLGIEEIYALVDDLIAAHGDWLPGWLHR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctgcacctaaaattacatttatcggcgctggttcgacgattttcgttaaaaat
attcttggtgatgtgttccatcgtgaggcgctgaaaacggcgcatattgccctgatggat
atcgatcccacccgcctggaagagtcacacattgtggtgcgcaagttgatggattcagca
ggggccagcggcaaaatcacctgccacacccaacagaaagaagccttacaggatgctgat
tttgtggtggtggcatttcagattggcggttatgaaccttgcacggtgactgatttcgag
gtctgtaagcggcatggtctggaacaaaccattgccgatacgctggggccgggcggcatt
atgcgtgcgctacgtaccattccgcacctgtggcagatttgcgaggacatgacggaagtc
tgccctgatgccaccatgctcaactacgttaacccaatggcgatgaatacctgggcgatg
tatgcacgctatccgcatatcaagcaggtagggctgtgccattcggtgcagggaacggcg
gaagagctggcgcgtgacctcaatatcgatccggctacgctgcgttaccgttgcgcaggt
atcaaccatatggcgttttacctggaactggagcgtaaaaccgcagacggtagctacgtg
aatctctatcctgaattgctggcggcttatgaagcagggcaggcaccgaagccaaatatt
catggtaatactcgctgccagaatattgtgcgttacgaaatgttcaaaaagctgggctac
ttcgtcacagaatcgtcagaacattttgctgagtacacaccgtggtttattaagccaggt
cgtgaggatttgattgagcgttataaagtaccgctggatgagtacccgaaacgctgcgtc
gagcagctggcgaactggcataaagagctggaggagtataaaaacgcctcccggattgat
attaaaccgtcacgggaatatgccagcacaatcatgaacgctatctggactggcgagccg
agtgtgatttatggcaatgtccgtaacgatggtttgattgataacctgccacaaggatgt
tgcgtggaagtggcctgtctggttgatgctaatggcattcagccgaccaaagccggtacg
ctaccttcgcatctggccgccctgatgcaaaccaacatcaacgtacagacgctgctgaca
gaagctattcttacggaaaatcgcgaccgtgtttaccacgccgcgatgatggacccgcat
actgccgccgtgctgggcattgaagaaatatatgctcttgttgacgacctgattgccgcc
cacggcgactggctgccaggctggttgcaccgctaa

DBGET integrated database retrieval system