KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_4315Help
Entry
ECSF_4315         CDS       T02077                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ese00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ECSF_4315
Enzymes [BR:ese01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ECSF_4315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4694650..4695972
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLHLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLESIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLTSGKLAKDDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMDTRALG
MAVVAMGGGRRQASDTIDYSVGFTYMARLGDQVDGQRPLAVIHAKDENSWQEAAKAVKAA
IKLADKAPESTPTVYRRISE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcgctgagcgatgaa
gaaattcgcttctttatcaacggcattcgcgacaacactatctccgaagggcagattgcc
gccctcgcgatgaccattttcttccacgatatgacaatgccggagcgtgtctcgctgacg
atggcgatgcgagattcaggaaccgttctcgactggaaaagcctacatctgaatggcccg
attgttgataaacactcgaccggcggcgtcggcgatgtgacttcgctgatgttggggcca
atggtcgctgcctgcggcggctatattccgatgatctccggtcgcggcctcggccatact
ggtggtacgctcgacaaactggaatccatccctggcttcgacatcttcccagatgacaac
cgtttccgcgaaattattaaagatgttggcgtggcgattattggccagaccagttcactg
gctccggcggataaacgtttctacgcgacccgcgatattaccgcaaccgtggattccatc
ccgctgatcactgcctcgatcctggcgaagaaactggcggaaggtctggatgcactggtg
atggacgtgaaagtcggtagcggtgcgtttatgccgacctacgaactctctgaagccctt
gccgaagcgattgttggcgtggctaacggcgctggcgtgcgcaccaccgcgctactcacc
gacatgaatcaggtgctggcctccagtgccggtaacgcggttgaagtacgtgaagcggtg
cagttcctgactggtgagtaccgtaacccgcgtctgtttgatgtcacgatggcgttgtgt
gtggagatgcttacctccggcaaactggcgaaagatgacgccgaagcgcgcgcgaaattg
caggcggtactggacaacggtaaagcggcagaagtctttggtcgtatggtagcggcacaa
aaaggcccgaccgacttcgttgagaactacgcgaagtatctgccgacagcgatgctgacg
aaagcagtctatgctgataccgaaggttttgtcagtgaaatggatacccgcgcgctggga
atggcagtggttgcaatgggcggcggtcgccgtcaggcatctgacaccatcgattacagc
gtcggctttacttatatggcgcgtctgggcgaccaggtagacggtcagcgtccgctggcg
gttatccacgcgaaagacgaaaacagctggcaggaagcggcgaaagcggtgaaagcggca
attaaacttgccgataaagcaccggaaagcacaccaactgtctatcgccgtatcagcgaa
taa

DBGET integrated database retrieval system