KEGG   Exiguobacterium sibiricum: Exig_0251Help
Entry
Exig_0251         CDS       T00687                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00330  Arginine and proline metabolism
esi01100  Metabolic pathways
Module
esi_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Exig_0251
Enzymes [BR:esi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Exig_0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ACB59737
JGI: Exig0251
UniProt: B1YHV3
Position
269867..270739
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIASQPTHEDAKGVLYGMPMDWTVSFRPGSRFGPARIREVSLGLEEYSP
YLDGDIADAKLFDAGDIPLPFGNAQKSLDMIEEYVDSLLTAGKFPLGMGGEHLVTWPVVK
AFDKHYEDFVVLHFDAHTDLRDSYEGEPLSHSTPLKKIANLIGPENCYSFGIRSGMKEEF
EWAKTSGYNLFKYEIVEPLKAVLPKLAGKKVYVTIDIDVLDPSAAPGTGTQEIGGVTTKE
LLEVVHMIARADVDVIGADLVEVCPAYDQSDMTAIAAAKVLREMMIGFIK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttgatgaagcttactcaggtaaggtatttatcgcgagtcaaccgactcacgaa
gatgcaaaaggtgtgttgtacggtatgccgatggactggacggtcagtttccgtcccggt
tcacggtttggtccggcccggatccgtgaagtgtcactcggactcgaagaatacagtcca
tatcttgacggtgatatcgccgatgcaaaattatttgacgccggtgacatcccgttgccg
ttcggtaatgcgcaaaaatcacttgatatgattgaagagtacgtcgactcgttgttgacg
gcaggcaagttcccgcttggtatgggcggcgaacacctcgtcacgtggccagtcgtcaaa
gcctttgataaacattacgaagatttcgtcgtgctgcattttgatgcacacacggattta
cgtgattcgtatgaaggcgaaccattatcacattcaacaccacttaaaaagattgcgaat
ttgatcggaccggaaaactgttattcgttcgggattcgttcaggaatgaaagaagagttc
gaatgggcaaaaacgtccggttacaacctgttcaaatacgaaatcgttgaaccgttgaaa
gccgttttaccaaagcttgccggtaaaaaggtctacgtgacgatcgatatcgatgtcctt
gatccgtcagcggcaccgggaacgggaacacaggaaatcggcggcgtgacgacaaaggaa
ttacttgaagtcgtccatatgattgcacgggctgatgttgatgtcatcggagccgatctc
gtcgaggtttgcccggcgtatgaccagtcggacatgacagcgattgcggctgctaaagtc
ttgcgtgaaatgatgatcgggttcattaaataa

DBGET integrated database retrieval system