KEGG   Exiguobacterium sibiricum: Exig_0375Help
Entry
Exig_0375         CDS       T00687                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
esi  Exiguobacterium sibiricum
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:esi00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
395550..397544
Genome map
AA seq 664 aa AA seqDB search
MYLGVDYYPEQTPRALWEEDFRLMKELGVNVVRLAEFAWTMMEPEEGVYDFRFWDDIIER
LSAAGFDIVLGTPTATPPAWMCHKYPEILPADEHGVTISFGARRHYTVHSETYQRFSVAI
TTEMAKRYGKHSRVIGWQTDNEYGHEKSDRSYSDVDRAAFQVWLKNRYGTLDALNETWGT
VFWSQIYTAWEQIPVPRKVYQEHNPSLLVDFDRFCADGYNHYNKLQVDALREHIHPEAFI
THNLVYSDMAVNQQQMAQDLDYVAFDNYPVWGGLPEPNRFEKMASDHDLCRSSKQGKGFW
VMEQLSGAQGWSKIGYLPRPGHIRLWTYQAVARGAEAIVYFRFRAALFGTEEFCHGIIDH
DGKPKRKFNEVKQIMTELNTFGDEINASSYRAEVGVYFDQENVWAWTHQPHSDAFDFRTE
FVRFYGGAVRRQASTDIVFPGDKLDQYKLIIVPLYFLTNPTFDQALIDYMEQGGHVIFTY
RTGVKDPHNNVLPLTLPGQFATYAGIEIDEYESLQAVQENRVEGIGKFAGQGSPARLWCD
LITPTTAEPLAVYRDTFYDGVAAVTRNEYKGMITYIGASIDDAMIDTIYRQAFLDAGVQT
FEAPDQVEIVRRHGETRDFLFLMNHDTKASRDVVLDAAYQELNTNETYSGTVTLAPLETL
ILTT
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaggcgtcgattattacccggaacaaactccacgtgcgttatgggaggaagac
ttccgattgatgaaagaacttggtgtcaacgtcgttcggttggcggaatttgcctggacg
atgatggagccggaagaaggagtttacgatttccggttttgggacgatatcatcgaacgc
ttgagtgccgccggttttgacatcgtcctcgggacaccgacggcaacaccaccggcctgg
atgtgtcacaagtatccggagattcttccggcagacgagcacggcgtgacaatcagtttc
ggagcccgtcgccattatacggttcacagcgaaacgtaccaacgtttttccgttgccatc
acgacagaaatggcgaaacgctatggaaaacactcgcgtgtcattggttggcagacggac
aacgaatacggtcatgagaaatcagaccgttcctacagcgatgtcgaccgggctgctttc
caggtctggctcaaaaaccgttacggcacgctcgatgcgttaaatgaaacatggggaacc
gtcttctggagtcaaatctatacggcatgggagcaaatcccggtgccgcggaaagtctat
caggaacacaatccatcgttacttgtcgacttcgaccgtttctgtgccgacggttacaac
cattacaacaaactgcaagtcgatgcgctccgggaacacatccatccggaggccttcatt
acccataacctcgtgtacagcgacatggccgtcaatcagcagcagatggcacaggatctt
gattatgtcgcctttgataactatccggtctggggcggtttgccggaaccgaaccgtttc
gagaagatggcgagcgatcatgacctttgccgctcctcaaaacaagggaaaggtttttgg
gtgatggagcagctcagcggagcgcaaggctggagcaaaatcggttacttgccgcgcccg
ggacatatccggttgtggacgtatcaggctgtcgcgcgcggtgccgaagcgatcgtctat
ttccgtttccgggcggcgttgttcggaacggaagagttttgtcatgggatcatcgatcac
gacggaaaaccgaagcgtaaattcaacgaagtcaaacaaatcatgaccgaactgaacacg
tttggtgacgagattaacgcgagtagctatcgggcggaagtcggcgtgtatttcgatcaa
gaaaacgtctgggcctggacccatcagccgcacagtgatgcgtttgatttccggaccgag
ttcgtccgtttctacggtggtgccgtccggcgtcaagcgtcgacggatatcgtcttcccg
ggagacaaactggatcaatataaattaatcatcgttccgctgtacttcctgacgaatccg
acattcgatcaagcgttaatcgattacatggagcagggcggacacgtcatcttcacgtac
cggaccggcgtcaaggatccgcacaacaatgtcctgccactgacgttgcctggtcagttc
gcaacgtatgccgggattgaaatcgatgagtacgaatcgttgcaagccgtgcaggaaaac
cgggtggaagggatcggaaaattcgcgggacaaggctcaccggcccgtctctggtgtgat
ttgattacaccgacgacagccgaaccgcttgctgtctaccgcgatacgttttatgacggc
gtcgctgccgtgacacgcaacgaatacaaaggaatgattacctatatcggcgcatcgatt
gacgatgcgatgatcgatacgatttaccgtcaagcgtttctcgatgccggtgttcaaacg
tttgaagcaccggatcaagtcgagattgtacgccgtcatggtgagacacgtgatttcctc
ttcctgatgaatcacgatacgaaagcaagccgggacgttgtgctcgatgctgcctatcaa
gagttgaatacgaacgagacatatagtggaacagtgacgctcgccccactcgagacgctg
attctgacaacgtaa

DBGET integrated database retrieval system