KEGG   Exiguobacterium sibiricum: Exig_0376Help
Entry
Exig_0376         CDS       T00687                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
esi  Exiguobacterium sibiricum
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Exig_0376
  Lipid metabolism
   00561 Glycerolipid metabolism
    Exig_0376
   00600 Sphingolipid metabolism
    Exig_0376
Enzymes [BR:esi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Exig_0376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
397559..399691
Genome map
AA seq 710 aa AA seqDB search
MAILELPNQRFVLEGQHVAHVVTIGQHGKVLHTYFGARLPYPSDYEALPNPVLAHSSFES
PDGVAVYDFIPFGEMVYTEPTLKSEREDGQRISQFVFERAEQSGNGLILWLFDSLQELRV
GIKYDLYETYDMIGRSLVIENTGTQSVRLTTAQSFAMGILQRPDLNLHHFAGTWTGEFQK
QVTPLTSGRKTIDSRRGVTSHQANPWFALEHGATESAGEVIYGHFAYSGNWSMHFEQDAF
GFVQLSGGMNEFDFSWRLEAGQHLTTPEFYIGYAPDGFAGMSARAHDFQRDVIMPESDRN
KVRPVLYNSWEATYFDVTEHGQRTLVDQAAAIGCELFVVDDGWFGERNSDQAGLGDWVVN
PEKFPNGLTPLIDYVKQQNMSFGLWVEPEMVNPDSNLYRTHPDWIYHSPGARRTTSRNQF
VLNIGLPEVEQFVFRMMDELLATHAIDYIKWDMNRAFSEPALPGATPAEQQELWKRHVDA
LYRIFDRLRVCHPEVDFEACAGGGGRIDLGILKRTEQVWTSDNTDPLDRLTIQHDFSFAY
NAKMMSCWVTDGPNWLNGRNLPLATRFVSSMQGTLGIGGNLSEWTTEELAEAAEWIATYK
TIRETVQFGRQYRLKADRVAASLMQYTSNDQTVILAVAPMRKHGIGHYHFRLAGLEETTL
YQVEDRQLSGAYLMQQGLTWNYTNDYEARCLRIQPVHRSIPTSESKEPIV
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggccattcttgaactgccgaatcagcgtttcgtcctcgaaggacaacacgtcgcgcat
gtcgtgacaatcggacagcacggcaaagtgttgcatacgtattttggagcgcgtctgccg
tacccatccgactatgaagccttaccgaatccggtcctggcacacagctcatttgaatcg
ccggacggggttgcggtctatgacttcattccatttggtgagatggtctacacagaaccg
actttaaaatcagaacgggaggacgggcaacgaatcagtcagttcgtttttgaacgcgcc
gaacaatccggcaatggattgatcttatggttgtttgattcgttacaggaactccgggtc
ggtatcaaatacgacctgtacgaaacgtacgatatgatcgggcgatcactcgtgattgaa
aacacaggaacacaatccgtccggttgacgacggcccaatcgtttgcgatggggatttta
caacgaccggacttgaacttacaccacttcgcgggaacatggaccggtgaattccaaaaa
caagtcacaccgctgacatcgggacgtaagacaattgacagccgacggggtgtgacgagt
caccaggcgaatccgtggttcgctttggaacacggcgcaacggaatcagccggcgaagtc
atttacggacatttcgcttattccggcaactggtcgatgcacttcgagcaggatgccttc
ggattcgtccagctatcgggcgggatgaatgagtttgatttcagctggcgacttgaagcc
ggtcagcatcttacgacaccggaattttatatcggatacgcgccagacggctttgccggg
atgagtgcccgcgcccacgatttccagcgggacgtcatcatgccggaatcggaccggaac
aaggttcggccggtgctctataactcctgggaagcgacctattttgacgtgacggaacac
ggtcaacgaacactggtggatcaagccgctgccatcggctgtgaactgtttgtcgtcgat
gacggctggttcggtgaacggaactccgaccaggccggtcttggcgactgggtcgtcaat
ccggagaagtttccgaacggattaacgccgttgattgattatgtgaaacaacaaaacatg
tcatttggactttgggtcgaaccggagatggttaatccggattcaaatttataccggacc
catcctgactggatttatcacagtccgggtgcccgtcggacgacatcacgcaatcagttt
gtcttgaatatcggcttgccggaagtggaacaattcgtattccggatgatggatgaactg
ctcgcaacccacgccattgattacatcaaatgggatatgaaccgtgcattttcggaaccg
gctctcccgggtgcgacaccggcagaacaacaggaattatggaagcggcatgtcgatgcg
ctgtaccggatttttgacagattgcgcgtctgtcatccggaagttgattttgaagcgtgt
gccggaggcggcggacggattgatctcggaattctcaaacggacggaacaagtctggacg
agtgacaatacggatccactggatcgcttgacgatccaacacgatttctcctttgcctac
aatgcgaagatgatgagttgctgggtgacggatggtccgaactggctcaacggtcggaac
ttaccgcttgcaacacgcttcgtgtcttcgatgcagggaacactcggcatcggcggtaac
ttaagcgaatggacaacggaagaattggcggaagcagctgaatggattgcgacgtacaag
acgattcgggaaaccgttcaattcggtcgtcagtaccggttgaaggcggaccgcgtggcg
gcttccctcatgcaatatacttcaaacgatcaaacggtgattctggcggtcgccccgatg
cgtaaacacggaatcggtcactaccatttccggttagccggccttgaggaaaccacactc
tatcaggttgaagatcgtcaactgagtggtgcttacttgatgcaacaaggtctgacctgg
aactacacgaacgattatgaagcacgttgcctgcggatccaaccggttcatcgcagcata
cctacatcagagtcaaaggagccgatcgtatga

DBGET integrated database retrieval system