KEGG   Exiguobacterium sibiricum: Exig_0380Help
Entry
Exig_0380         CDS       T00687                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00010  Glycolysis / Gluconeogenesis
esi00052  Galactose metabolism
esi01100  Metabolic pathways
esi01110  Biosynthesis of secondary metabolites
esi01120  Microbial metabolism in diverse environments
esi01130  Biosynthesis of antibiotics
Module
esi_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Exig_0380
   00052 Galactose metabolism
    Exig_0380
Enzymes [BR:esi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Exig_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACB59864
JGI: Exig0380
UniProt: B1YII1
Position
403376..404395
Genome map
AA seq 339 aa AA seqDB search
MTKQTALIRETDLIRHTLTQPGIEVEIWNYGGIINDIRVADRDGRIESVVLGFDTLKEYR
DHSPYFGAIVGRVAGRIGQAQMEVEGTVYPLAANDGRHHLHGGIKGFDQTLFDIVEAATD
RLHLRLVSPDGTEGYPGNVTLDAIYQLDGLELTLTMHATTDQTTPLNLTNHTYWNLSGNL
QRDILDHQLTIPSEMYLPVGADLLPTGELRDVTGTPLDFRSGRSIRNGAESDHPETVAAG
HGYDHPFLLSGQPIRLEDPASGRSLEVTTNQPVVILYTGTQLETDYEIRGVRSRPSLGLC
LETQVHPNAVNEPSFPDILVKPNQIYHWEMTYRFGVNND
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaacagacagcattgatccgggagacggatctcattcgtcacacgctgacgcaa
ccgggaatcgaagtcgagatttggaattatggcggtatcatcaatgacattcgtgttgcg
gatcgggatggccggatcgagagtgtcgttctgggttttgacacattaaaggagtaccgg
gaccattctccatatttcggggccatcgtcggccgggtcgccgggcgtatcggacaagcg
caaatggaagtggaaggaaccgtctatccactggcagcaaatgatggcaggcatcatctg
cacggaggcatcaaaggatttgatcaaacactttttgacatcgtcgaagccgcaacggac
cggcttcacctccggttggtcagtccggacggaacggaagggtaccccgggaacgtcacg
ctcgatgccatctatcagctggacggtctcgaattgacgctgacgatgcacgcgacgacg
gatcagacgacaccgttgaatctgacgaatcatacgtactggaatttgtcggggaactta
caacgggatatcctcgaccatcaattgacgatcccaagtgagatgtacttgcctgtcgga
gcggatttactgccaaccggtgagttgcgggacgtgacggggactccccttgattttcgt
tccggacgttcgatccgcaatggtgcggagtccgatcatccggaaacggtcgcagctgga
catgggtacgatcatccgtttctgctctcgggacagccgattcggttggaagacccggca
agtggccggtctcttgaagtgacaaccaatcaacccgtcgtcattctctatacggggacg
caactcgagacggattatgaaatccgcggtgtccgttcccgtccttcactcggactgtgt
cttgaaacgcaggttcatccgaatgcagtgaatgaacctagtttcccggatattttggtt
aaaccaaatcagatctaccactgggaaatgacttaccggtttggtgtaaataacgattga

DBGET integrated database retrieval system