KEGG   Exiguobacterium sibiricum: Exig_0427Help
Entry
Exig_0427         CDS       T00687                                 

Definition
(GenBank) Acireductone dioxygenase ARD
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00270  Cysteine and methionine metabolism
esi01100  Metabolic pathways
Module
esi_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Exig_0427
Enzymes [BR:esi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Exig_0427
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Exig_0427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1
Motif
Other DBs
NCBI-ProteinID: ACB59909
JGI: Exig0427
UniProt: B1YIX9
Position
complement(445717..446256)
Genome map
AA seq 179 aa AA seqDB search
MATVLFQKTNERYTDQNEVSAFLASRGVLYEQWDVSKLPAELVDTYTLTDADKQTILDTF
QSEITDVSERRGYQTADIISLSDATPNLDELLVNFQKEHHHTDDEVRFIVSGHGVFAIQD
DEVGYYNIELNPGDLISVPVNTRHYFTLQEDRKVVAVRIFVTTDGWVPIYEKDPIETAN
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagtacttttccagaaaacaaacgaacggtatacggatcaaaatgaggtatct
gcttttctcgcttcacgtggtgtcctgtatgaacaatgggatgtctcgaagcttccggct
gaactggtcgacacgtacacgttgacggatgcggacaaacaaacgattcttgatacattc
caatcggaaatcaccgatgtttcggaacgacgcggttatcagacggctgatatcatctcc
ctgtctgacgcaacaccgaacttggatgagttgctcgtcaacttccaaaaggagcatcac
catacggatgacgaagtccggttcatcgtcagcgggcacggtgtgtttgcgatccaggat
gacgaagtcggctattacaacattgagttgaacccgggtgatttgatttccgtaccagtc
aacacacgccattacttcacgctccaagaggatcgaaaagttgtggcggtccggattttc
gtgacaacggacggctgggttccgatttatgagaaggatccgattgaaacagcaaactaa

DBGET integrated database retrieval system