KEGG   Exiguobacterium sibiricum: Exig_0715Help
Entry
Exig_0715         CDS       T00687                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
esi  Exiguobacterium sibiricum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Exig_0715
Enzymes [BR:esi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Exig_0715
Exosome [BR:esi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Exig_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
756738..758228
Genome map
AA seq 496 aa AA seqDB search
MENYILSLDQGTTSTRAILFNRSGEIVHSAQREFTQYFPKPGWVEHNANEIWGSVLSVVA
TCLTEANVKATQIAGIGITNQRETAVVWEKETGKPIHNAVVWQSRQTAEICEELRSAGHA
ELFRAKTGLLIDAYFSGTKVKWILDHVEGSRERAERGELLFGTIDTWLIWKLSGGKAHVT
DYSNASRTLMYNIHELKWDDELLQLLDVPKAMLPEVRPSSEVYAHTAGYHFFGESVPIAG
AAGDQQAALFGQACFEKGMAKNTYGTGCFMLLNTGDKAVTSEHGLLTTIAWGIDGKVQYA
LEGSIFVAGSAIQWLRDGLRLINDAKETEAYATRVTSSDGVYVVPAFVGLGTPYWDSDVR
GAVFGLTRGTEKEHFIRATLESLAYQTRDVLTAMEQDSGIEMSALRVDGGAVKNDFLMQF
QSDIIQAPVERPEINETTALGAAYLAGLAVGFFENQKQISAHWKMDRRFEMDMAEAESED
LYAGWKKAVQAAMLFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggagaactacattttgtcattagatcaaggaacaacgagtacacgggcgattttattc
aaccgttccggagaaatcgttcattccgcacaacgtgagtttacgcagtactttccaaaa
ccaggttgggtcgaacacaatgccaatgaaatttggggaagtgtcctttcggtcgttgca
acctgtttaacggaagccaacgtcaaagcgacacaaatcgctggaatcggcattacgaac
caacgggaaacagcggtcgtctgggagaaagagactggaaaaccgattcataatgcagtt
gtctggcaatcgagacaaacagctgaaatttgtgaagagttacggagtgcaggacatgcc
gaattgttccgtgcaaaaacaggtttgttgattgatgcctatttctccggaacgaaggtc
aagtggattcttgatcacgttgaaggttcccgggaacgggcagaacgtggtgaactgttg
tttggaacgattgatacctggttgatttggaagttgtcaggcggtaaagcccatgtcacg
gattattccaatgccagccggacgttgatgtataacatccacgagctaaaatgggatgac
gaattacttcagctcctcgatgttccaaaagccatgcttcctgaagtccgtccgtcttct
gaagtttatgcgcatacagctggctatcacttcttcggtgaatcggttccgattgccgga
gctgccggagatcaacaggccgctttattcggtcaagcttgtttcgaaaaaggaatggcg
aaaaacacatacggaacaggatgtttcatgttgctgaatacgggcgacaaagctgtgaca
tcggaacacggtctcttgacgacgattgcgtggggaatcgacggaaaagtccagtatgcg
ctcgaaggcagtatttttgtcgccggttcagcgattcaatggttacgagatggtcttcgc
ctgattaacgatgcgaaggaaacagaagcttacgcgacgcgtgtgacgtcttcagacggg
gtctacgtcgttcctgcattcgtcggtctcgggacaccgtactgggacagtgatgtccgt
ggtgcagtcttcggtctgacgcggggaacggaaaaagaacacttcatccgggcgacactt
gaatcgctggcatatcagacgcgtgacgtcttgacagcgatggaacaggattccggaatc
gaaatgtctgccttacgtgtcgatggtggtgccgttaaaaatgatttcctcatgcaattc
cagagtgatatcatccaggcaccggtcgagcgtccggaaattaatgaaacgacggccctc
ggggcagcatatcttgcaggactagctgttggattctttgagaatcaaaaacagatttca
gcccactggaagatggatcgtcgctttgagatggatatggcggaagcagagagcgaagat
ctttacgctggatggaaaaaagctgttcaagcggcgatgttgtttaaatga

DBGET integrated database retrieval system