KEGG   Exiguobacterium sibiricum: Exig_0874Help
Entry
Exig_0874         CDS       T00687                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
esi  Exiguobacterium sibiricum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Exig_0874
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Exig_0874
   00052 Galactose metabolism
    Exig_0874
   00500 Starch and sucrose metabolism
    Exig_0874
   00520 Amino sugar and nucleotide sugar metabolism
    Exig_0874
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Exig_0874
   00524 Butirosin and neomycin biosynthesis
    Exig_0874
Enzymes [BR:esi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Exig_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
929165..930115
Genome map
AA seq 316 aa AA seqDB search
MKWLLGVDIGGTTVKMAILDLQGIIVEKWEIETVILNDGEQIPGDIAHSFFEKCQQSNKR
VEDFVGAGIGAPGFIDFNTGVVEKAVNIGWNNFELVGEFERLTGLPAVIENDANAAAIGE
MWKGAGSGATELLAVTLGTGVGGGLITNGQIVHGTVGMAGEIGHITMLPEGGVMCGCGRK
GCLETIASATGVARLGLEKRKGQVTSLNDIKAVTAKDVFEAYSQGDTVANEVVEEVTFHL
GLAISNLANSFNPEIIVIGGGVSKAGEALMAPLQETFKRFALPRVFGSTTFKIAELGNDA
GVIGCAWLAKQMFLKK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttactgggtgtagatatcggcggaacgacggtcaagatggcgattttagac
ttacaaggaattatcgtggaaaaatgggaaatcgaaacggttatcttaaatgatggggaa
caaattccgggagacatcgcccattctttctttgaaaaatgccagcaaagcaataaacgc
gttgaagattttgttggagccggaatcggggcaccgggattcatcgactttaacacgggt
gtcgtcgaaaaagcggtcaatatcggttggaacaatttcgaactcgtcggagaattcgag
cgtttaaccggattaccggcagtgatcgagaatgacgcgaacgcagcagcaatcggtgag
atgtggaaaggggccggaagcggagcgacagaactgcttgccgttacactcggaaccggg
gtcggaggcggattgatcacaaacggtcaaatcgttcacggtacagtcggtatggccggt
gaaatcggtcatatcacaatgttgccggaaggtggtgtcatgtgtggttgcggtcgtaaa
gggtgtttggaaacgattgcttccgcaacaggtgtcgcccggcttggtcttgaaaaacga
aaaggacaggtcacttctttgaacgacatcaaagcggttacggcaaaagatgtgtttgaa
gcgtattcgcaaggggatacggtagcgaacgaggtcgtggaagaagtaacgttccacctt
ggactcgccatttcgaatttagccaacagctttaatcctgaaatcatcgtcattggcggc
ggcgtttcaaaagcaggcgaggcgctgatggctccattacaagagacatttaagcgattt
gctttgccgcgggtcttcggatcaacgaccttcaaaatcgctgaactgggtaatgacgca
ggtgtcatcggctgtgcttggttggcgaaacaaatgtttctgaaaaaataa

DBGET integrated database retrieval system