KEGG   Exiguobacterium sibiricum: Exig_0920Help
Entry
Exig_0920         CDS       T00687                                 

Definition
transketolase central region
Orthology
K00167  
2-oxoisovalerate dehydrogenase E1 component, beta subunit [EC:1.2.4.4]
Organism
esi  Exiguobacterium sibiricum
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:esi00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
969272..970255
Genome map
AA seq 327 aa AA seqDB search
MTTLSLIEAINSAIKEEMERDESVFVLGEDVGVRGGVFRATQGLLEQFGEERVIDAPLAE
SAIAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIVSEAAKIRYRSNNDWSCPIVIRAPFG
GGIHGALYHSQSVEAMFNSTPGLKIVIPSNPYDAKGLLKAAIRSNDPVLFFEHKRGYRLL
KGEVPEGDYTVEIGKADVKREGEDLTVITYGLCVQFALEAAARLEKDGIDVHILDLRTVY
PIDREAVVAAARKTGKVLLVTEDNKEGSVMSEVSAIIAEEALFDLDAPIERLCGPDVPAM
PYAPTMEKFFNVSSEKIEDKIRTLHAY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgacgacattaagtttaatcgaagccattaacagtgcgatcaaagaagagatggaacgc
gatgaatccgtcttcgtcctcggagaagacgtcggcgtccgcggcggtgttttccgcgcg
acacaaggattgttggagcagttcggggaagaacgtgtcatcgacgcgccactcgctgaa
agtgcaattgccggagtcggaatcggcgcagcgatgtacggaatgcgtccaattgctgaa
atgcagtttgcggatttcatcatgccggccgtcaaccaaatcgtcagtgaagcggcaaaa
atccgttaccgttcgaacaatgactggtcatgcccaatcgtcatccgcgcaccattcggc
ggcgggattcacggtgccctttaccattcccaatccgtcgaagcgatgttcaattcgacg
ccgggcttaaaaatcgtcattccgtctaatccatatgatgcgaaaggtttgctgaaagca
gccatccgttcaaacgatcctgtcctgttctttgaacataaacgcggctatcgtctgctc
aaaggtgaagtgccagaaggagactatactgttgaaatcggtaaagccgatgtcaaacgg
gaaggtgaagatttaacggtcatcacgtacggtctttgtgttcagtttgcccttgaagca
gcggcgcgtcttgagaaagacggcatcgatgttcatattcttgatttacggacggtttat
ccgattgaccgggaagcggtcgtcgcggcagcccggaaaaccggaaaagtcttactcgtt
acagaagacaacaaagaaggcagtgtcatgagtgaagtatctgccatcatcgcggaagaa
gcgttgtttgatctcgatgcaccaatcgagcgtctctgcggtccggatgtaccggcgatg
ccatacgctccgacgatggagaaattctttaacgtctcgagtgaaaaaatcgaggacaaa
atccggacgctgcacgcgtactaa

DBGET integrated database retrieval system